CAZyme Information: MGYG000001418_00707

Basic Information

• Species: Aeromicrobium massiliense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Propionibacteriales; Nocardioidaceae; Aeromicrobium; Aeromicrobium massiliense
• CAZyme ID: MGYG000001418_00707
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315	MGYG000001418_1|CGC3	32289.28	4.9842

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001418	3314835	Isolate	not provided	not provided

• Gene Location: Start: 691078; End: 692025 Strand: +

Full Sequence      

MSVTEVQARIGQIESYLATLDGRVAGLTSGRAAAASGPSAASATPFAAQLADAQAAGSSE
GGQKVVDTAKKYLGVPYVWGGTDPAKGLDCSGLVQQVYGELGYDLPRVSRDQAKVGTAVP
SLDQARPGDLLAFNSPVTHIGIYVGDGKMIHAPKPGEKVRIEDVYDTPTAIRRVIGAEPA
TAAASSTAAAGSYGVLFERAEARYGVDAGLLAAVAKQESGFDAGAVSPAGAQGLMQLMPA
TARGLGVTDAFDPAQAVDGAARLLRDLTQRFGSTELALAAYNAGPGPVMRYDGVPPYAET
RNYVRSIMADLEGAR

Enzyme Prediction     

No EC number prediction in MGYG000001418_00707.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	209	311	4.2e-34	0.7703703703703704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	8.04e-43	208	312	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	8.81e-41	193	309	6	144	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd13403	MLTF-like	6.88e-36	197	309	1	154	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	1.12e-34	197	291	1	102	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd16896	LT_Slt70-like	3.48e-34	198	312	9	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWF23102.1	9.29e-119	1	314	1	320
QIG42463.1	1.19e-113	1	311	1	346
QWZ08491.1	5.03e-107	1	309	1	317
QCC78165.1	1.96e-106	1	315	1	324
QCX28590.1	1.71e-104	63	315	60	322

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B8C_A	2.06e-20	59	164	25	131	Crystalstructure of NlpC/p60 domain of peptidoglycan hydrolase SagA [Enterococcus faecium]
7CFL_A	7.85e-19	61	164	13	122	ChainA, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_B Chain B, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_C Chain C, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_D Chain D, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile]
4XCM_A	7.03e-17	71	164	123	215	Crystalstructure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]
4HPE_A	4.23e-16	58	155	183	285	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]
4FDY_A	5.24e-15	63	155	192	289	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	8.59e-31	198	307	65	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	3.54e-29	191	310	1420	1540	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	3.54e-29	191	310	1420	1540	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
A4QFQ3	9.17e-21	48	152	86	188	Probable endopeptidase cgR_2070 OS=Corynebacterium glutamicum (strain R) OX=340322 GN=cgR_2070 PE=1 SV=1
O35010	2.30e-20	53	167	167	281	Gamma-D-glutamyl-L-lysine dipeptidyl-peptidase OS=Bacillus subtilis (strain 168) OX=224308 GN=ykfC PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001418_00707.