CAZyme Information: MGYG000001418_00977

Basic Information

• Species: Aeromicrobium massiliense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Propionibacteriales; Nocardioidaceae; Aeromicrobium; Aeromicrobium massiliense
• CAZyme ID: MGYG000001418_00977
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	MGYG000001418_1|CGC6	38340.78	4.5306

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001418	3314835	Isolate	not provided	not provided

• Gene Location: Start: 965146; End: 966228 Strand: +

Full Sequence      

MPLPEVPGVLSAEQAAATGDWIASVQLPSGAIPWFPGGHVDPWDHVQAAMGLTVAGHADA
AARAFGWLADAQADDGTWAAKYVDGEVVEDHVDANFCAYVAVGALHHHRVTGDDAVLART
WPVVRAAIDAVLSLQADDGTVRWARSADGSVADESLVTGNASIHMSLRCAIALARVVGVD
VPEWQDAAARLRHALDDHPERFSPRGRHAMDWYYPVLGGALHPDDASVLLDKRWDEFVVD
GLGIRCVHDHPWVTGAETCELVLALDAAGRRDDATTMLAAMQHLRDGDGSYWTGLVYADG
KRWPVETSTWTAATVLLAADALGRTTGANGLFRGEGLPAAHPGDELADFHPEEPCPCLAS

Enzyme Prediction     

No EC number prediction in MGYG000001418_00977.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3387	SGA1	3.50e-04	9	281	252	563	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].
TIGR01577	oligosac_amyl	0.003	65	202	320	457	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.
cd00688	ISOPREN_C2_like	0.009	20	139	59	177	This group contains class II terpene cyclases, protein prenyltransferases beta subunit, two broadly specific proteinase inhibitors alpha2-macroglobulin (alpha (2)-M) and pregnancy zone protein (PZP) and, the C3 C4 and C5 components of vertebrate complement. Class II terpene cyclases include squalene cyclase (SQCY) and 2,3-oxidosqualene cyclase (OSQCY), these integral membrane proteins catalyze a cationic cyclization cascade converting linear triterpenes to fused ring compounds. The protein prenyltransferases include protein farnesyltransferase (FTase) and geranylgeranyltransferase types I and II (GGTase-I and GGTase-II) which catalyze the carboxyl-terminal lipidation of Ras, Rab, and several other cellular signal transduction proteins, facilitating membrane associations and specific protein-protein interactions. Alpha (2)-M is a major carrier protein in serum and involved in the immobilization and entrapment of proteases. PZP is a pregnancy associated protein. Alpha (2)-M and PZP are known to bind to and, may modulate, the activity of placental protein-14 in T-cell growth and cytokine production thereby protecting the allogeneic fetus from attack by the maternal immune system.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXT85520.1	9.07e-158	3	357	4	350
AWB92907.1	1.33e-157	2	356	6	352
QGG42083.1	3.81e-157	3	356	7	352
SNV12656.1	4.45e-141	3	358	11	361
AYA25170.1	7.28e-140	3	358	11	361

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000014	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001418_00977.