CAZyme Information: MGYG000001418_01462

Basic Information

• Species: Aeromicrobium massiliense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Propionibacteriales; Nocardioidaceae; Aeromicrobium; Aeromicrobium massiliense
• CAZyme ID: MGYG000001418_01462
• CAZy Family: GT39
• CAZyme Description: putative dolichyl-phosphate-mannose--protein mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
514		57429.04	7.8682

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001418	3314835	Isolate	not provided	not provided

• Gene Location: Start: 77172; End: 78716 Strand: -

Full Sequence      

MPRLPAVALDRHLLGWAGPIGLAVLAFVLRVWNLGFPNRLLFDETYYAKDAYSLLHHGYV
RDWSEDVNDDFARGDFSGMLDLPTQIVHPDGGKWMLALGQAVFGTDSFGWRISAAVAGAL
TVLVLARLVLRLTGSLVASWLAGLLLTLDGVHFVLSRTALLDVFLCLWVVVAVACLVADR
DWIAVRLDRFHAWRPWQVAAGVSLGLACSVKWSGVYVLAVAGLAIVLWEVHARRAAWRAD
RATLRRPGLVLTTLRVGAPAFVLLVGIALVVYLLTWTGWLVHHEAYELRFGRGYGDTPAW
GSYVGTDPGSWWGETWNALRSLWHFHVMAYEFHTGDYLAGQTHPYQSHPLGWLVLERPVG
VDAQNDLPAASCGAPADSSCMREVLVLGNPLVWWSGVLAVVGSLLAWMRTRHWAWSLPAL
GLVATWLPWFFSADRPIFLFYAVVILPFMIIAVALVVDGLRRALHGRARTALHVVLALYV
VAVVVLFVYFHPIWTDDLVSYDQWRDRMWFGRWI

Enzyme Prediction     

No EC number prediction in MGYG000001418_01462.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	23	279	3e-70	0.9820627802690582

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1928	PMT1	1.16e-20	18	228	26	228	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	8.09e-13	22	228	3	201	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4346	COG4346	2.02e-07	88	229	136	259	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].
COG1807	ArnT	5.04e-07	13	228	4	195	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam16192	PMT_4TMC	4.36e-04	340	458	18	141	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGG42390.1	2.51e-220	1	514	4	517
AWB91395.1	1.36e-217	1	514	4	517
AXT85871.1	7.82e-208	15	514	20	520
ALX04048.1	6.34e-207	13	514	1	510
SKB05078.1	2.31e-191	16	514	16	506

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_B	3.33e-06	19	238	68	280	Structureof S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L8F4Z2	3.14e-68	15	513	37	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
P9WN04	1.39e-67	9	513	38	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	1.39e-67	9	513	38	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
Q8NRZ6	6.93e-50	22	513	41	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1
Q9C100	5.90e-09	19	239	61	274	Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
13	32
107	129
136	155
159	178
190	207
212	230
251	273
384	406
413	432
437	459
472	494