CAZyme Information: MGYG000001418_01466

Basic Information

• Species: Aeromicrobium massiliense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Propionibacteriales; Nocardioidaceae; Aeromicrobium; Aeromicrobium massiliense
• CAZyme ID: MGYG000001418_01466
• CAZy Family: GH23
• CAZyme Description: Resuscitation-promoting factor Rpf2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370		39746.59	6.0777

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001418	3314835	Isolate	not provided	not provided

• Gene Location: Start: 82200; End: 83312 Strand: +

Full Sequence      

MAFARRFKALSWPMIAVYTAVLLVVAGGTIAYAGLSKTVTLVVDGKEQTVRTFGDDVASV
LEAQDVKVGLDDRVVPAQATSISDGDTVEVSYARPVTLTVDGQQKTVTTWEHTVDEALAA
LGVEPESGAFVSRSMDSRVPLKGLQLVVSNPKTVEIRQGDDARRVTSTGVTVADVLEDAG
VRPGQEDEVKPALDTALADGDRVRVVDIEVVNRVESVAVDHETTVRKDPDAFEGEVDVVT
KGKDGKARQQVRYVLADGKKRSRTVVSTKTVREPVTQVEERGTKKPESSSSGDNSVWDRI
AKCESGGNWQTNTGNGYYGGLQFSAATWKSVGGPGLPHQHSREVQIKYAKILQARAGWGQ
WSCAAKVGVH

Enzyme Prediction     

No EC number prediction in MGYG000001418_01466.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3583	YabE	1.06e-57	11	314	11	309	Uncharacterized conserved protein YabE, contains G5 and tandem DUF348 domains [Function unknown].
pfam06737	Transglycosylas	7.26e-31	293	364	1	75	Transglycosylase-like domain. This family of proteins are very likely to act as transglycosylase enzymes related to pfam00062 and pfam01464. These other families are weakly matched by this family, and include the known active site residues.
cd13925	RPF	1.69e-30	295	363	1	70	core lysozyme-like domain of resuscitation-promoting factor proteins. Resuscitation-promoting factor (RPF) proteins, found in various (G+C)-rich Gram-positive bacteria, act to reactivate cultures from stationary phase. This protein shares elements of the structural core of lysozyme and related proteins. Furthermore, it shares a conserved active site glutamate which is required for activity, and has a polysaccharide binding cleft that corresponds to the peptidoglycan binding cleft of lysozyme. Muralytic activity of Rpf in Micrococcus luteus correlates with resuscitation, supporting a mechanism dependent on cleavage of peptidoglycan by RPF.
pfam07501	G5	9.55e-15	210	284	1	75	G5 domain. This domain is found in a wide range of extracellular proteins. It is found tandemly repeated in up to 8 copies. It is found in the N-terminus of peptidases belonging to the M26 family which cleave human IgA. The domain is also found in proteins involved in metabolism of bacterial cell walls suggesting this domain may have an adhesive function.
pfam03990	DUF348	7.46e-10	39	77	1	39	Domain of unknown function (DUF348). This domain normally occurs as tandem repeats; however it is found as a single copy in the S. cerevisiae DNA-binding nuclear protein YCR593. This protein is involved in sporulation part of the SET3C complex, which is required to repress early/middle sporulation genes during meiosis. The bacterial proteins are likely to be involved in a cell wall function as they are found in conjunction with the pfam07501 domain, which is involved in various cell surface processes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWB91400.1	1.89e-123	11	364	102	467
QGG42386.1	1.35e-120	20	364	97	444
AXT85867.1	7.49e-117	5	364	52	409
QNL94973.1	2.27e-105	22	370	8	360
SKB05062.1	5.13e-105	22	369	8	352

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5E27_A	1.91e-29	134	370	7	248	ChainA, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],5E27_B Chain B, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis]
1XSF_A	3.60e-20	293	370	27	108	ChainA, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis]
4KL7_A	6.12e-20	295	370	1	80	ChainA, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KL7_B Chain B, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KL7_C Chain C, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KL7_D Chain D, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_A Chain A, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_B Chain B, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_C Chain C, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_D Chain D, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis]
4EMN_A	6.29e-20	295	370	2	81	ChainA, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis],4EMN_B Chain B, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis],4EMN_C Chain C, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis],4EMN_D Chain D, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis]
3EO5_A	1.83e-19	293	370	90	171	ChainA, Resuscitation-promoting factor rpfB [Mycobacterium tuberculosis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6M6N7	4.52e-49	28	370	34	374	Resuscitation-promoting factor Rpf2 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=rpf2 PE=1 SV=1
A0R3E0	5.68e-46	23	370	13	362	Resuscitation-promoting factor RpfB OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=rpfB PE=3 SV=2
P9WG28	1.56e-45	37	370	25	362	Resuscitation-promoting factor RpfB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=rpfB PE=3 SV=1
P9WG29	1.56e-45	37	370	25	362	Resuscitation-promoting factor RpfB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rpfB PE=1 SV=1
H8EZH5	1.56e-45	37	370	25	362	Resuscitation-promoting factor RpfB OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) OX=652616 GN=rpfB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.908885	0.056664	0.001967	0.000388	0.000225	0.031909

TMHMM  Annotations     

start	end
13	35