CAZyme Information: MGYG000001418_02108

Basic Information

• Species: Aeromicrobium massiliense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Propionibacteriales; Nocardioidaceae; Aeromicrobium; Aeromicrobium massiliense
• CAZyme ID: MGYG000001418_02108
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
238		25084.74	4.3591

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001418	3314835	Isolate	not provided	not provided

• Gene Location: Start: 687508; End: 688224 Strand: +

Full Sequence      

MTCTRVALVRTGQTGVVRTPSTLLAVCLVGALAACSEDRQRVDVEVPRTVSAPVLDGEPD
RVWLRDSARRTGIPARVLTAYARAADRVAADGCELGWNTLAGIGRVETSHARFGGAETSE
AGDVRPRILGPRLDGGPGIRAIEDTDGGELDGDTTWDRAVGPMQFIPTTWDRWGADGDGD
GVRDPHSIDDATLAAARYLCDAGDDLGDDAGWVDAVLTYNNSGAYARKVAEAATEYAG

Enzyme Prediction     

No EC number prediction in MGYG000001418_02108.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	96	234	4.9e-22	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2951	MltB	3.01e-28	63	237	115	276	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
cd13399	Slt35-like	7.94e-22	93	233	1	106	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam13406	SLT_2	2.69e-08	156	199	152	196	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.
cd00254	LT-like	6.60e-04	159	199	24	60	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYN36611.1	6.18e-72	42	236	34	230
SDU80958.1	5.14e-68	51	237	66	252
QGG41802.1	6.32e-67	24	237	14	223
AWB92656.1	1.60e-65	21	237	4	225
QIM17052.1	2.62e-65	23	236	20	252

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000661	0.055817	0.943413	0.000030	0.000053	0.000028

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001418_02108.