CAZyme Information: MGYG000001419_00609

Basic Information

• Species: Timonella senegalensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Cellulomonadaceae; Timonella; Timonella senegalensis
• CAZyme ID: MGYG000001419_00609
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
594		63238.46	4.4229

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001419	2986640	Isolate	not provided	not provided

• Gene Location: Start: 686398; End: 688182 Strand: +

Full Sequence      

MFSRHKTAFSATLAGVLAAGMLTALPAAAATDENPTPTTTINGFRNVGYYGQWKATGETG
ATVKRTFVDSGQGANLTHINYSFGNVAGPQEALDAARAAGAKGLDNVDPYTCFISDQVAP
GAGQTEVAGDADSDFLHLYTASESVLGVADSAKSKLSGNFNQLAQLKRLYPDLKINVSLG
GWSWSKSFSPAVATAESRAKLAKSCVDLYIRGNLPVIDGKGGAGAAAGIFDGFDLDWEWP
GAPDWSQEVGNHVDEANDKANFIAFAAELRSQLDALEGETGRDYEISAFLPASPGVISAG
GWNTAELWDSLDYGNLQGYDLWGGWSAQTGHQGNIYGDPAHNWGLGLDSIISTYTRAGVD
PAKLNIGLAGYGQGWKDADPEPWTESGGGIGQLTWDQLKSHDLEIHHEYTEDGKFNATWA
YDAAKREYWSFDDPTAVAEKAKYAQSLGLGGVDFWEVGNDINGELSAASAEVFRGLPTGP
VAGEGALICSATPNTNSSPWNAQTTYKKGDLVYLDGKIFEAQWYAKGDVPGNGKKNTPWS
TYTACSVDPGALQPWANDTIYTKGDQVTYNGETYTAKWWTRGEAPGGKNSPWAK

Enzyme Prediction     

No EC number prediction in MGYG000001419_00609.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	45	464	1.8e-63	0.9459459459459459

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	3.21e-93	46	460	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	8.60e-74	45	460	1	334	Glyco_18 domain.
COG3325	ChiA	5.90e-65	44	478	38	441	Chitinase, GH18 family [Carbohydrate transport and metabolism].
pfam00704	Glyco_hydro_18	2.60e-64	45	460	1	307	Glycosyl hydrolases family 18.
cd02872	GH18_chitolectin_chitotriosidase	3.08e-41	158	460	56	341	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAY59876.1	1.08e-279	7	592	11	597
QIK83396.1	5.55e-173	32	476	3	450
ANJ26359.1	3.99e-142	41	594	47	621
QNO38578.1	4.73e-142	8	594	19	607
ARK04512.1	2.70e-139	8	592	24	629

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1KFW_A	3.02e-118	38	481	3	429	Structureof catalytic domain of psychrophilic chitinase B from Arthrobacter TAD20 [Arthrobacter sp. TAD20]
4W5U_A	3.24e-39	21	468	14	402	Crystalstructure of chitinase 40 from thermophilic bacteria Streptomyces thermoviolaceus. [Streptomyces thermoviolaceus],4W5U_B Crystal structure of chitinase 40 from thermophilic bacteria Streptomyces thermoviolaceus. [Streptomyces thermoviolaceus]
6BT9_A	1.54e-38	47	460	40	448	ChitinaseChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]
1ITX_A	5.00e-38	35	465	3	411	ChainA, Glycosyl Hydrolase [Niallia circulans]
3ARO_A	1.43e-35	75	475	163	568	CrystalStructure Analysis of Chitinase A from Vibrio harveyi with novel inhibitors - apo structure [Vibrio harveyi],3ARP_A Crystal Structure Analysis of Chitinase A from Vibrio harveyi with novel inhibitors - complex structure with DEQUALINIUM [Vibrio harveyi],3ARQ_A Crystal Structure Analysis of Chitinase A from Vibrio harveyi with novel inhibitors - complex structure with IDARUBICIN [Vibrio harveyi],3ARR_A Crystal Structure Analysis of Chitinase A from Vibrio harveyi with novel inhibitors - complex structure with PENTOXIFYLLINE [Vibrio harveyi],3ARV_A Crystal Structure Analysis of Chitinase A from Vibrio harveyi with novel inhibitors - complex structure with Sanguinarine [Vibrio harveyi],3ARW_A Crystal Structure Analysis of Chitinase A from Vibrio harveyi with novel inhibitors - complex structure with chelerythrine [Vibrio harveyi],3ARX_A Crystal Structure Analysis of Chitinase A from Vibrio harveyi with novel inhibitors - complex structure with Propentofylline [Vibrio harveyi],3ARY_A Crystal Structure Analysis of Chitinase A from Vibrio harveyi with novel inhibitors - complex structure with 2-(imidazolin-2-yl)-5-isothiocyanatobenzofuran [Vibrio harveyi],3ARZ_A Crystal Structure Analysis of Chitinase A from Vibrio harveyi with novel inhibitors - complex structure with 2-(imidazolin-2-yl)-5-isothiocyanatobenzofuran [Vibrio harveyi],3B8S_A Crystal structure of wild-type chitinase A from Vibrio harveyi [Vibrio harveyi],3B8S_B Crystal structure of wild-type chitinase A from Vibrio harveyi [Vibrio harveyi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P36909	5.48e-40	47	460	243	594	Chitinase C OS=Streptomyces lividans OX=1916 GN=chiC PE=2 SV=1
P11220	9.23e-40	32	468	233	604	Chitinase 63 OS=Streptomyces plicatus OX=1922 GN=chtA PE=1 SV=2
P20533	1.83e-37	35	504	35	489	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
A6N6J0	1.13e-33	122	478	77	410	Endochitinase 46 OS=Trichoderma harzianum OX=5544 GN=chit46 PE=1 SV=1
P48827	8.80e-33	122	478	76	403	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000647	0.998108	0.000230	0.000534	0.000239	0.000196

TMHMM  Annotations     

start	end
7	29