CAZyme Information: MGYG000001419_01324

Basic Information

• Species: Timonella senegalensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Cellulomonadaceae; Timonella; Timonella senegalensis
• CAZyme ID: MGYG000001419_01324
• CAZy Family: AA10
• CAZyme Description: GlcNAc-binding protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
263		27094.86	6.7315

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001419	2986640	Isolate	not provided	not provided

• Gene Location: Start: 413415; End: 414206 Strand: -

Full Sequence      

MKKRFRAAAVVAAMGFAAIFPALTALPASAHGWVTDPPSRQANCATGATPFDCGSVKYEP
QSVEAPKGSMQCSGGNAAFSILDDNSKAWPVKNVGSSVNIQWKLTANHATSLWEYFVDGK
LHQTFDQGGAQPSPTISHTLTNLPAGKHTILARWNVSNTVNAFYNCIDVFVGPGGGGTTD
GGSTDGGSTDGGSTDGGTTSGGSTDGSSTSCPSAYDAAAVYLAGAKVSHNGDVWLAKWWT
QGQAPGTTGEWGQWQNLGPCTSK

Enzyme Prediction     

No EC number prediction in MGYG000001419_01324.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA10	31	169	6.4e-28	0.9887640449438202

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd21177	LPMO_AA10	5.44e-41	31	169	1	179	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 10 (AA10). AA10 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs), which may act on chitin or cellulose. The family used to be called CBM33. Activities in this family include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54), lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56), lytic chitin monooxygenase (EC 1.14.99.53), and lytic xylan monooxygenase/xylan oxidase (glycosidic bond-cleaving) (EC 1.14.99.-). Also included are viral chitin-binding glycoproteins such as fusolin and spheroidin-like proteins.
pfam03067	LPMO_10	2.24e-31	31	169	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.
PRK13211	PRK13211	6.23e-30	28	169	21	191	N-acetylglucosamine-binding protein GbpA.
COG3397	COG3397	8.66e-29	23	172	22	208	Predicted carbohydrate-binding protein, contains CBM5 and CBM33 domains [General function prediction only].
cd12215	ChiC_BD	6.70e-12	214	255	2	41	Chitin-binding domain of chitinase C. Chitin-binding domain of chitinase C (ChiC) of Streptomyces griseus and related proteins. Chitinase C is a family 19 chitinase, and consists of a N-terminal chitin binding domain and a C-terminal chitin-catalytic domain that effects degradation. Chitinases function in invertebrates in the degradation of old exoskeletons, in fungi to utilize chitin in cell walls, and in bacteria which use chitin as an energy source. ChiC contains the characteristic chitin-binding aromatic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACV09037.1	3.40e-105	2	262	3	252
SQH21170.1	3.40e-105	2	262	3	252
QDW61374.1	1.99e-104	3	260	2	259
QIK84567.1	6.97e-102	9	260	2	240
QDW61373.1	1.64e-95	3	260	4	277

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AA7_A	1.15e-77	31	171	1	141	Structuraland functional characterization of a chitin-active 15.5 kDa lytic polysaccharide monooxygenase domain from a modular chitinase from Jonesia denitrificans [Jonesia denitrificans],5AA7_B Structural and functional characterization of a chitin-active 15.5 kDa lytic polysaccharide monooxygenase domain from a modular chitinase from Jonesia denitrificans [Jonesia denitrificans],5VG0_A Room temperature X-ray crystallographic structure of a Jonesia denitrificans lytic polysaccharide monooxygenase at 1.1 angstrom resolution. [Jonesia denitrificans DSM 20603],5VG0_B Room temperature X-ray crystallographic structure of a Jonesia denitrificans lytic polysaccharide monooxygenase at 1.1 angstrom resolution. [Jonesia denitrificans DSM 20603],5VG1_A Neutron crystallographic structure of a Jonesia denitrificans lytic polysaccharide monooxygenase [Jonesia denitrificans DSM 20603],5VG1_B Neutron crystallographic structure of a Jonesia denitrificans lytic polysaccharide monooxygenase [Jonesia denitrificans DSM 20603]
5FTZ_A	3.72e-27	31	169	1	170	AA10lytic polysaccharide monooxygenase (LPMO) from Streptomyces lividans [Streptomyces lividans 1326]
2BEM_A	3.24e-23	31	169	1	166	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_C Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2LHS_A Structure of the chitin binding protein 21 (CBP21) [Serratia marcescens]
2BEN_A	6.67e-22	31	169	1	166	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens],2BEN_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens]
5WSZ_A	2.58e-20	31	169	1	164	Crystalstructure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_B Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_C Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_D Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3KIM2	2.89e-49	23	172	23	171	Lytic chitin monooxygenase OS=Streptomyces ambofaciens (strain ATCC 23877 / 3486 / DSM 40053 / JCM 4204 / NBRC 12836 / NRRL B-2516) OX=278992 GN=SAM23877_0645 PE=1 SV=1
Q8EHY2	3.50e-21	23	169	20	193	GlcNAc-binding protein A OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=gbpA PE=3 SV=2
Q838S1	6.86e-18	10	169	8	191	Lytic chitin monooxygenase OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0362 PE=1 SV=1
Q6LKG5	2.08e-14	30	169	24	200	GlcNAc-binding protein A OS=Photobacterium profundum (strain SS9) OX=298386 GN=gbpA PE=3 SV=1
Q8D7V4	3.78e-14	45	169	47	198	GlcNAc-binding protein A OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=gbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000227	0.999127	0.000166	0.000184	0.000153	0.000138

TMHMM  Annotations     

start	end
7	29