CAZyme Information: MGYG000001419_02324

Basic Information

• Species: Timonella senegalensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Cellulomonadaceae; Timonella; Timonella senegalensis
• CAZyme ID: MGYG000001419_02324
• CAZy Family: GH171
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388		41992.63	4.3321

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001419	2986640	Isolate	not provided	not provided

• Gene Location: Start: 109243; End: 110409 Strand: +

Full Sequence      

MAVITGADRIVENPALLEHKRWGIVTNYTGVTSSLELTATALHKAGAPLVAIFGPEHGTR
GTAQAGFSEESEADPETGLPVYDTYLKEGAELDAIIAAADVDVLVFDMQDLGVRFYTYVW
TFVDCMRSAARLGIDVVVLDRPNPLGGVKVEGPALDESGFSSFVGRVDVATRHGLTVGEL
LDMVARRDTAAGLPEANLRVIEMIGWDREMLWADTGLPWVMPSPNMPTPDSALAYVGTGL
FEGTLMSEGRGTTRPFELIGAPWVDSRYVETLNALELPGVRFREAWFNPTFHKFAGEVVA
GVQLHILDTNSFAPVATAVAMIDAAKELYPDGFAWRLPERSAESLSNTIPFIDLLWGSDS
LRTTIDAGGRGGDLPLVTTHPRDAQLLY

Enzyme Prediction     

No EC number prediction in MGYG000001419_02324.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH171	23	369	1.1e-120	0.9211267605633803

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07075	DUF1343	6.83e-169	23	368	1	335	Protein of unknown function (DUF1343). This family consists of several hypothetical bacterial proteins of around 400 residues in length. The function of this family is unknown.
COG3876	YbbC	1.33e-120	2	368	25	382	Uncharacterized conserved protein YbbC, DUF1343 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ26319.1	9.09e-150	2	368	12	377
ADD42431.1	1.22e-144	5	368	10	372
QTX04081.1	5.55e-140	1	374	1	368
QIZ99936.1	7.24e-139	5	368	8	370
ACZ88443.1	1.08e-138	3	388	4	380

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K05_A	1.62e-60	5	374	15	377	Crystalstructure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343],4K05_B Crystal structure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343]
4JJA_A	6.86e-37	3	373	6	345	Crystalstructure of a DUF1343 family protein (BF0379) from Bacteroides fragilis NCTC 9343 at 1.30 A resolution [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40407	5.81e-89	3	368	37	387	Uncharacterized protein YbbC OS=Bacillus subtilis (strain 168) OX=224308 GN=ybbC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001419_02324.