CAZyme Information: MGYG000001419_02423

Basic Information

• Species: Timonella senegalensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Cellulomonadaceae; Timonella; Timonella senegalensis
• CAZyme ID: MGYG000001419_02423
• CAZy Family: GT39
• CAZyme Description: putative dolichyl-phosphate-mannose--protein mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
571		64289.65	7.8268

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001419	2986640	Isolate	not provided	not provided

• Gene Location: Start: 217071; End: 218786 Strand: -

Full Sequence      

MVGVGETTNPDNSVTVDPNQGNAEGLDTTLAVDVPNPSSPEPSTYDRLMLALFSARQLAL
DATRSSRMWGWLGPLLVAVVGGFLRFIRLGTPDTLVFDETYYVKGAYTLLRNGYENDWPD
EPNDAWNAGDLDVYLSKADYVVHPPLGKWMIAFGMWIGDPHNPFFWRFSTALVSVIAIFL
TAWVIRKMTGSTLAGVAAGGLFAIDGVAIVHARTGLLDSFLMFWVLIAFVLLVQDRFWRR
KRLARIVAARLDSGLALSHWGPKLGWSWWRFAAALALGLSCGIKWSGLYFVAAFCVMAVL
WDAGARKAVGVQGWLVGTFWREAVPSALIMLPTALVGYLAAWSSWFLNTNSYGRLWHEKN
PGAYWEWLPTFLTDKLEVLRSFLHYHQSMMTFHTGLSSEHSYEAPAWGWLFQLRPTSFFW
DKFASGEGGCESSQCASAVTSLGNPLIWWLATLAFVYLFYRVFRHADWIAGGIVMGIIAG
WVPWLFFPDRTIFTFYVIAFAPFMYMALAYVGFLAWEKWSVVASKRQTVTGVLAGLSLVI
VAVSVFFYPIWTAMLVPYRFWQIHMWLTSWI

Enzyme Prediction     

No EC number prediction in MGYG000001419_02423.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	77	346	5.3e-69	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1928	PMT1	3.27e-26	72	571	25	694	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	6.84e-12	76	294	2	192	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4346	COG4346	6.70e-11	143	525	136	421	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].
pfam16192	PMT_4TMC	4.89e-10	380	561	1	196	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG1807	ArnT	2.59e-09	63	357	1	233	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SQH22064.1	1.99e-233	50	571	53	572
ACV09603.1	1.99e-233	50	571	53	572
ACZ22941.1	3.15e-233	32	571	46	585
ASE10117.2	2.48e-232	50	571	125	644
QDW64328.1	1.63e-203	38	571	36	565

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WN04	3.25e-78	67	570	40	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	3.25e-78	67	570	40	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
L8F4Z2	3.14e-76	67	570	34	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
Q8NRZ6	6.13e-61	76	570	40	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1
P42934	2.62e-07	72	289	67	256	Dolichyl-phosphate-mannose--protein mannosyltransferase 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT6 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
68	87
163	185
190	212
216	233
285	304
324	346
446	463
468	487
492	514
529	551