CAZyme Information: MGYG000001420_00561

Basic Information

• Species: Alistipes senegalensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes senegalensis
• CAZyme ID: MGYG000001420_00561
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
876		98269.43	4.6621

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001420	3985129	Isolate	not provided	not provided

• Gene Location: Start: 713342; End: 715972 Strand: +

Full Sequence      

MNVANLRTAGRWLALYCLPLLAGSCGKRPAIADMRCEYLASPISVDTPSPRFTWTYEDAD
AFVQAGYRLCVATAPEKLDLPDIWNSGEIAGSRPFAAMPDGGLLVSRTPYYWRVEAWDAG
GRRIVSPVAEFETALMETSEWQARWITDAHDKDFVPAPMLRRAFAVRSGVERARLYVSAA
AYAKMSLNGEPVSGNLLDPGYTHYDKRNLYAVHDVTDRLREGENVLSAVLGNGFYNAIQP
VATWSFEVARWRGRARMICELHIDYADGTHEVVCSDGSWRTTADGPYLSNNIYSGDVYDA
RREIPGWDRPGFDDSAWAQAVEVAAPSPLLKAQSMPAVRATCETEPVGVRSFGDTIWVFD
FGVNLTGLCRLEIEGERGTQITMTHGEFVQPSGRIEMRNLDIYYKPLPGYDFQTDTYILK
GEGRETWTPDFTYHGFQYVELRSSAPVKLDKTSLTARFMHTDVSSVGKFSCSNGLFNRIW
EMTRRTYLNNLTSIPTDCPQREKNGWTADGYLAMDLALLNYDGMAFYEKWLDDFIDNQNE
AGRLAGIIPTAGWGYDDWIGPVWDASAFIIPYTLYNYYGDLRPVEKMWPVCERYLEYLAT
REEADGGVTYGIGDWVFYRTQTPTDYTSTCFYYYDNVLMARFAELLGRDGERYARKAAQL
RELINTKYYDAEKGLYANGSQAAQGVALYLGIVPESDAQRVADNLARMIADNDYFLDFGT
IGSKTVLRMLTRYGHVETAYKMASQTEGPSWGWWVSQGFTTLAETWMLSPEWRDASINHV
FLGDVAAWYVNDLAGINFDPADPGFGHIVIAPHFVEALDWAAASYDSVRGEICSEWRRCG
GCVTLKVTIPANTTADIRVGGEIVATVSGGVHEFTF

Enzyme Prediction     

No EC number prediction in MGYG000001420_00561.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	353	858	1.9e-155	0.9880952380952381
CBM67	143	326	5.4e-42	0.9659090909090909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.06e-102	466	788	3	335	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.21e-63	170	341	3	171	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	5.12e-32	353	460	4	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	3.48e-17	795	855	1	59	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG1626	TreA	3.89e-04	569	709	280	449	Neutral trehalase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA23306.1	0.0	5	876	7	878
QDM10804.1	0.0	18	876	15	878
QUT32044.1	0.0	18	876	15	878
CBK67657.1	0.0	18	876	15	878
QRM99258.1	0.0	18	876	15	878

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	6.65e-149	33	859	34	898	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	3.64e-111	37	862	12	997	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.58e-90	30	874	3	863	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	8.67e-113	40	857	41	904	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	1.56e-110	37	862	12	997	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	1.86e-98	37	856	38	875	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KNB2	1.00e-93	37	859	42	878	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000250	0.127113	0.872416	0.000099	0.000071	0.000047

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001420_00561.