CAZyme Information: MGYG000001420_00582

Basic Information

• Species: Alistipes senegalensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes senegalensis
• CAZyme ID: MGYG000001420_00582
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
595	MGYG000001420_1|CGC10	66000.05	5.6766

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001420	3985129	Isolate	not provided	not provided

• Gene Location: Start: 750498; End: 752285 Strand: +

Full Sequence      

MTDPMSRLLKLAVPIFSVCFSLSVSAARPQLPPAWDGSSVRFDSRTYGYMPPVRIVAQEQ
ADLISGGDLLLEAGNGQADLQNARICVLRSRDGRRPGLLLDFGRELQGGLRIVTGMPADN
RPVRVRIRFGESVSEAMCDIDGANGASNDHAVRDFTLTLPWLGAVECGDSGFRFARIDLL
DDDRELHLKQVEAVFQYRDIPYIGSFRSSDERLDRIWATGAYTVHLCMQEYLWDGVKRDR
LVWVGDLHPEIMTVNSVFGYNEVVPRSLDLARDTTPLPGWMNGISSYSLWWIIIHSDWYR
YHGDRAYLAEQRPYLTALLRQLFEKIGPDGRERLDGTRFLDWPSSGDAASTAAGLQSLTI
LALDAGAGLCEALGDTALAAECRAKAALMRKCPIGEGGEAKQGRSLMVLAGLADPVATDR
DYISKGGSNGFSTFYGYYMLRAMAAAGNYEGALERIREYWGAMLDLGATTFWEDFDMAWL
PAARIDEPVPAGMRDLHRECGAYCYKGFRHSLCHGWASGPTAWLTEYVLGVEVVEPGCRR
LRIDPHLGDLEWVEGTFPTPYGAVKIRHEKAPDGMVKSRVEAPRGVKTELVKHNG

Enzyme Prediction     

No EC number prediction in MGYG000001420_00582.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	98	590	7.7e-101	0.9781746031746031

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.45e-19	204	528	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.24e-07	530	591	1	62	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT48045.1	4.68e-277	43	587	22	580
QUR50485.1	4.67e-272	43	587	23	579
QUT19201.1	2.69e-271	43	587	23	579
ABR43079.1	7.95e-271	43	587	23	579
QRO16730.1	7.95e-271	43	587	23	579

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.43e-40	97	566	193	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	1.95e-18	98	529	95	543	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000287	0.998919	0.000286	0.000165	0.000161	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001420_00582.