CAZyme Information: MGYG000001420_00602

Basic Information

• Species: Alistipes senegalensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes senegalensis
• CAZyme ID: MGYG000001420_00602
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
983	MGYG000001420_1|CGC11	110688.6	7.3471

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001420	3985129	Isolate	not provided	not provided

• Gene Location: Start: 781649; End: 784600 Strand: -

Full Sequence      

MKKTLILIAFMLGLSGPSMKAQVRLTEKTSGKEVFRLSAPNRQTVIRYDANDATVVGKTA
ELLAADLGLVTGRQGLTTTGDTLPRNADVIIAGTIGQSALIDRLIAQRKIAADTIAGCWE
RYLIQTVAKPLPGVSEALVIAGSDRRGTAYGLLAVSDAIGVSPWYWWADVPVKPRTSLYL
HVHPEVSKTPSVRYRGLFINDEDWGLLPWARHTFDPERGNIGPKTYAKVCELLLRLKANY
LCPAMHEASTAFNKIPENKMVADSFAIVMGSVHCEPLLFNNASEWDRKTMGEWDYVKNKE
GINSVLRRRVRENAAYENVYTLALRGLHDRAMTGSSDIKERVRQLEGALHDQRQLLVDEL
GKPGEEIPQAFTPYKEVLEVYSNGLELPDDVTIIWPDDNYGYMKRLSGERERKRSGRSGV
YYHASYLGKPHDYLWISSTSPALMYEELRKAYDATADRIWLLNAGDIKACEPAVDLFLAM
AYDIDRFDYANAADYQARTLSRIFGSQYYDTFREITATFYDLAFQRKPELMGWGYQWATD
KHGRERNTDTDFSCANYREASRRIAEYDRIGKLAEKVMTNLPEIEKPAFYQLLYYPVRAS
EQLNKMILDGQRNRWYARQGRAAANPLRDEIRAHYDSLQNLTAGYNELLGGKWNRIMTTR
QGFACSYYQLPELDSVTLQSGASLGIWVESEDVLKGQRSFHALPAFSVYTRRTGRIDVFN
KGNRPLVWTASPSDEWIRLDRTSGTTSTQQELTVEIDWEKVPVGERILGSVRIDAGSERE
TVLVSVFNPATPAPATIKGLYVEDNGCVSIPAAGFHRKFENEQVKMTLIENLGYEKEAVM
MGHPLSSVQRTGGRNTPRLEYDFYSFSSGSVDVYTYMLPTFPLSADRPFAHETSSTETKY
GVAIDEGPVMNPTTSSFEYAQAWYENVLKNCAVKKTTLHIDRPGRHTVKIICGDPGVVVQ
KIVLDFGGMKRSYAGPPPTEVIR

Enzyme Prediction     

No EC number prediction in MGYG000001420_00602.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	35	661	6.9e-216	0.8206599713055954

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	5.69e-156	188	530	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	1.59e-53	801	978	2	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
cd14948	BACON	0.002	728	785	28	81	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUR45612.1	0.0	6	980	7	982
ALJ39780.1	0.0	18	979	17	980
EDO12283.1	0.0	18	979	17	980
QRQ54524.1	0.0	18	979	17	980
ALJ47615.1	0.0	18	979	54	1017

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	1.39e-148	36	979	15	933	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
5BY3_A	3.09e-127	46	655	30	613	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
4C90_A	6.04e-102	35	657	44	640	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	6.15e-101	25	661	7	629	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	3.10e-100	25	661	6	628	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000666	0.986230	0.012385	0.000264	0.000228	0.000196

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001420_00602.