CAZyme Information: MGYG000001420_00796

Basic Information

• Species: Alistipes senegalensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes senegalensis
• CAZyme ID: MGYG000001420_00796
• CAZy Family: CE15
• CAZyme Description: Carbohydrate esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420	MGYG000001420_1|CGC15	46673.64	5.0905

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001420	3985129	Isolate	not provided	not provided

• Gene Location: Start: 1027430; End: 1028692 Strand: +

Full Sequence      

MRLFRKYALLLCCLGVSGVRAQEPAMNYDESRVPAYTLPDPLTMSDGRRVADAEGWMSER
RPELLALFESQIYGKAPGRPEGVHFEVLSEDRYALSNMATRKEIAVYFTDDEEHFMTLLL
YVPNKRTDAVPVFLGLNFKGNHTICDDPLVTPSTLRTEPGKGPSEGFPRAAAASRWPVEM
LIANGYGLATVYRGDIDPDYDDGFQNGVHPLFYRDGQTRPAPDEWGTIAAWAWGLSRAMD
YLETDEDVDAGRVAVIGHSRLGKAALWAGAVDTRFALVVSNDSGCGGAALARRRYAETVA
RINRLFPHWFCDNYKRYAGNEDALPVDQHELIALIAPRPVYIASAAGDKWADVKGEFLAG
VHATPVYELFGSEGLYGTELPPADEPCMSGRIGYHVRSGGHDITLYDWRQFVKFADNYLK

Enzyme Prediction     

No EC number prediction in MGYG000001420_00796.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE15	37	420	2.1e-104	0.9925650557620818

CDD Domains     

MGYG000001420_00796 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK63993.1	2.60e-258	1	420	1	426
QUR45646.1	2.53e-194	22	420	285	685
QDM10177.1	7.20e-194	22	420	285	685
QUT79457.1	1.03e-193	22	420	296	696
QDO70968.1	4.48e-186	26	420	39	434

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SYR_A	1.48e-149	8	420	6	427	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1]
6GRY_A	8.78e-149	29	415	5	392	GlucuronoylEsterase from Solibacter usitatus. [Candidatus Solibacter usitatus]
6GRW_A	2.49e-147	35	420	4	398	GlucuronoylEsterase from Opitutus terrae (Au derivative) [Opitutus terrae PB90-1],6GS0_A Native Glucuronoyl Esterase from Opitutus terrae [Opitutus terrae PB90-1]
6SYU_A	4.60e-147	35	420	22	416	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with xylobiose [Opitutus terrae],6T0I_A The wild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with the aldotetrauronic acid XUX [Opitutus terrae]
6SYV_A	1.31e-146	35	420	22	416	Theglucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1],6SZO_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-galacturonate [Opitutus terrae PB90-1],6T0E_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1],6T0E_B The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0K2VM55	8.34e-140	19	419	23	427	Carbohydrate esterase MZ0003 OS=Unknown prokaryotic organism OX=2725 GN=MZ0003 PE=1 SV=1
K5XDZ6	1.76e-25	38	377	44	342	4-O-methyl-glucuronoyl methylesterase OS=Phanerochaete carnosa (strain HHB-10118-sp) OX=650164 GN=PHACADRAFT_247750 PE=1 SV=1
D8QLP9	2.79e-25	38	388	36	341	4-O-methyl-glucuronoyl methylesterase OS=Schizophyllum commune (strain H4-8 / FGSC 9210) OX=578458 GN=SCHCODRAFT_238770 PE=1 SV=1
P0CU53	6.25e-25	31	377	35	344	4-O-methyl-glucuronoyl methylesterase 1 OS=Wolfiporia cocos (strain MD-104) OX=742152 GN=WOLCODRAFT_23632 PE=1 SV=1
P0CT88	1.86e-23	38	377	44	342	4-O-methyl-glucuronoyl methylesterase 2 OS=Phanerochaete chrysosporium (strain RP-78 / ATCC MYA-4764 / FGSC 9002) OX=273507 GN=e_gw1.11.1537.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000758	0.995812	0.002788	0.000237	0.000206	0.000180

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001420_00796.