CAZyme Information: MGYG000001420_01800

Basic Information

• Species: Alistipes senegalensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes senegalensis
• CAZyme ID: MGYG000001420_01800
• CAZy Family: PL8
• CAZyme Description: Chondroitinase-AC

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
721	MGYG000001420_2|CGC3	80311.18	9.1926

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001420	3985129	Isolate	not provided	not provided

• Gene Location: Start: 69570; End: 71735 Strand: +

Full Sequence      

MKRFLTYAALLACSAVHAGTGSLDALRAAFVRASTASYAPDRQLAERFIECSDSGRANDV
LLLQLYMSVHLPAEEVRRLLGLIDEQGRWSDIDYADRTRGRWQPTLHLTRLYALAKLWAD
PGSESYRSQRLRDVLHAGIGLWLRIDPRCPNWWHNEIGVPKKLTAILLMLGDEATPEEIA
GGLRILKRSQFGRTGQNKVWLAGNNLMKGLLTDDGELVQRARDAIAEEIRLTTGEGIQPD
WSFHQHGPQIQFGNYGLAYAESISFWFRVLEGSPYAFPAEQYDIVRRLLTDGICRSVWQG
TMDPSFCGRQVFIDAGRGKALSLAVTARNMAATGRPGSREFARIAKRNLRPGSREAAGSS
YYWRSDCGIHRSKRWYASVRMHSERTVGFEMTNRENLLANFSADGALLTMQHGAEYENIF
ACWDWRRIPGTTAYDDGAPIKCSDDADEKRNRSRWVGGLAADGLLCTTMELRRDSLRAVK
SNFLFEEIVVAVGAGIRNDAPPRELFTTLEQNRLRGEVVAGTSGGRLSIPEERPTGRSFR
PGEVQWIHHDGRGYLLLDEQEVRLSTAMQHGKWDPIDPFYRDRADSARIFKCWVEHRCDT
AGSYAYAILPCRNAKQTARTAAKRPVELLRNDDACQAVKYGRTVCAVFRRPGSVGAGGLT
LRVDAPAVVAIDLRTKRIAASSPCASALNVSLSDGKRRRTASLSLPDGDAMQGATVCGRL
K

Enzyme Prediction     

No EC number prediction in MGYG000001420_01800.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	360	613	3.3e-55	0.9845559845559846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01083	GAG_Lyase	2.08e-113	86	683	35	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
pfam02278	Lyase_8	6.39e-67	361	610	3	249	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam08124	Lyase_8_N	5.65e-34	73	330	26	302	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam02884	Lyase_8_C	1.92e-06	629	683	1	59	Polysaccharide lyase family 8, C-terminal beta-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK62766.1	5.60e-282	21	668	24	660
QCQ41166.1	2.50e-121	40	641	46	625
BAD48335.1	4.94e-121	40	641	46	625
AQT67414.1	6.08e-121	78	716	61	711
QRP90665.1	1.37e-120	40	641	46	625

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CB8_A	5.72e-68	80	671	32	625	CHONDROITINASEAC LYASE FROM FLAVOBACTERIUM HEPARINUM [Pedobacter heparinus]
1HM2_A	8.51e-68	80	671	54	647	ACTIVESITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HM3_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-Oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus],1HMU_A ACTIVE SITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HMW_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus]
1RW9_A	3.45e-31	109	718	77	730	Crystalstructure of the Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens]
1RWA_A	3.45e-31	109	718	77	730	Crystalstructure of Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens],1RWC_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens],1RWF_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens],1RWG_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens],1RWH_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens]
2WCO_A	9.58e-28	110	683	93	711	Structuresof the Streptomyces coelicolor A3(2) Hyaluronan Lyase in Complex with Oligosaccharide Substrates and an Inhibitor [Streptomyces coelicolor A3(2)],2WDA_A The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase in Complex with Chondroitin sulphate [Streptomyces violaceoruber]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59288	4.66e-67	80	671	54	647	Chondroitinase-AC OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=cslA PE=1 SV=1
Q9AQS0	2.48e-21	110	639	99	675	Xanthan lyase OS=Bacillus sp. (strain GL1) OX=84635 GN=xly PE=1 SV=1
Q53591	2.59e-18	89	638	304	925	Hyaluronate lyase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=hylB PE=1 SV=2
Q59801	8.14e-17	151	646	182	725	Hyaluronate lyase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=hysA PE=3 SV=1
C7S340	1.62e-06	375	681	593	903	Chondroitin sulfate ABC exolyase (Fragment) OS=Proteus vulgaris OX=585 GN=ChABCII PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003070	0.691606	0.304279	0.000364	0.000327	0.000322

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001420_01800.