CAZyme Information: MGYG000001420_02425

Basic Information

• Species: Alistipes senegalensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes senegalensis
• CAZyme ID: MGYG000001420_02425
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
248		28859.47	8.3555

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001420	3985129	Isolate	not provided	not provided

• Gene Location: Start: 791997; End: 792743 Strand: -

Full Sequence      

MIPKIIHFCWLSGEPYPPLIEHCINSWREKLPGYQFVLWDKAKADGIASEWVQEAYRNRK
YAFAADYIRCYALYHFGGIYLDADVEVLKNMDELLVCKSFLGYDSTGALEAAIIGAEPRC
PWIGCALEYYEGRHFVRPDGKFDVRPIPGMIYEKLHQLFDFKDRPDRVQELPEITLFPSV
YFSPKNYQTLKIKISSETYTVHHFDGKWIDATLKHRIKKAFHKILSCGLGESGHNKMVSL
IRAIKRMR

Enzyme Prediction     

No EC number prediction in MGYG000001420_02425.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	19	95	5.2e-23	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	5.84e-23	1	122	81	206	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	3.95e-15	23	95	7	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	2.25e-09	1	113	45	162	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	5.52e-04	25	84	132	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
pfam12919	TcdA_TcdB	0.001	4	39	1	35	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRM72494.1	3.57e-92	1	245	1	231
QRP88735.1	3.57e-92	1	245	1	231
QKH86603.1	9.04e-88	1	245	1	231
QCQ47332.1	2.58e-87	1	245	1	231
QLK84813.1	2.58e-87	1	245	1	231

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O14084	8.56e-11	2	183	64	216	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
P33300	1.46e-10	1	136	54	195	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
P38287	4.78e-10	1	136	61	202	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
Q10323	2.03e-09	2	123	57	181	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
Q9UT67	9.55e-08	1	131	81	214	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001420_02425.