CAZyme Information: MGYG000001420_02636

Basic Information

• Species: Alistipes senegalensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes senegalensis
• CAZyme ID: MGYG000001420_02636
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
782	MGYG000001420_2|CGC12	87221.84	7.8766

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001420	3985129	Isolate	not provided	not provided

• Gene Location: Start: 1058233; End: 1060581 Strand: -

Full Sequence      

MRRSVKIRALFCLFALLPLQNSGASLRECPGARWISTAEEGADCPNSWIAFRRDVELKAL
PAVAPVCIAADTKYWLWINGECVVFEGGLKRGPTPGSTYYDRVDIAPFLRKGTNRIAVLL
WHFGKDGFSHKDSGRAGLLFSATGKRFSLRSDSLWLCRIHPAFGDTGDPRPNFRLAESNI
RFDARRDIGPWQTAALSDLEGFRNAREIGCRGDAPWGGLVERPIPQWKDFGVREARFERF
SAGKTDSVIVRLPYNMQMTPVITLDDPQGGSPVGISTDHSFAGGTSNIRAEYVTRRGVQQ
YESLGWMNGQELRLTLPKHVALTRVAYRETGYDTEPQGSFRCDDDFYNRFWQKALRTLYV
NMRDNYFDCPDRERAQWWGDVVVLMGESFYAYSISAYALMRKAILELAGWQKPGGELFSP
IPAGNYDSELPGQMLAAVGRYGFWNYYMNTGDLETIRRVYPAVKRYLSLWKTDDTGLTAF
RKGGWTWGDWGNNRDIRLIFAGWHCLALEGAADMALALGLPEDAADYRALMVRVKEGFLR
CWDGNAFRHPEYHGSTDDRVQALAVLSGIADESYYGKLSEIFRTQFHASPYMEKYVMEAL
FRMGCGRYAMERTARRFADMVDDPGSTTLFEGWGIGEKGYGGGTTNHAWSGGALTVIAGQ
LCGIRPLEPGYSVFGVEPDPASFRDVSIRVPTVRGIVGEELRIEGARLSLRVIVPEGTTA
VVTLPQGAAGPRVDGRSPSAGQLRVAERYRKPARIQLSLTSGDYRIESEFDPAPDGLPVS
GS

Enzyme Prediction     

No EC number prediction in MGYG000001420_02636.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	291	724	1.1e-81	0.8809523809523809
CBM67	32	216	3.7e-30	0.9943181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.72e-31	338	652	4	331	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.05e-08	663	736	1	75	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKZ15800.1	0.0	34	767	17	748
QXU44133.1	0.0	10	769	22	779
ASM67368.1	0.0	33	736	27	730
QQT79846.1	0.0	33	736	26	729
QRP59702.1	0.0	33	736	26	729

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	1.21e-15	32	260	8	231	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000401	0.998912	0.000191	0.000161	0.000152	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001420_02636.