CAZyme Information: MGYG000001420_02737

Basic Information

• Species: Alistipes senegalensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes senegalensis
• CAZyme ID: MGYG000001420_02737
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
414		47600.93	4.9374

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001420	3985129	Isolate	not provided	not provided

• Gene Location: Start: 1221419; End: 1222663 Strand: +

Full Sequence      

MIAIFKHLILSLAALCCAACAGRAGGSPDFIRTDGVNLVDGNGNRFEIRGTNLGHWLNPE
GYLFQFPKSANSPRRIHEGLCQLVGPAYMERFWRTFRENYITREDIDYIASTGATTVRLP
FHYKLFTAEEYLGLHDPEEGFALVDRVVEWCRDAGLRLILDMHDCPGGQTGDNIDDSYGY
PWLFRSPEMQERFIAVWRGIAARYADEPTILGYDLMNEPIAHYFEDKEELNAELQPLMIR
TAKAIREVDSRHILILAGAQWNTNFKVYDDWTFDDNLIFTCHIYKCPPSVNSLKGFAAFR
DKSQCPMYMGETGENTDEWVGNFRRALDEMNIGWTFWTYKRLDARPSFVSVPMPEGWQKI
CDFLAADRSEYGFIREARPDQSEMRRVLDIYLENCKFANCRPNDTYVAALGLNP

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	88	343	1.2e-97	0.9883268482490273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	2.86e-30	89	339	15	268	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	8.42e-21	46	348	16	317	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBE18442.1	6.31e-161	1	414	5	418
AHW60616.1	1.14e-156	27	412	53	436
QIK53840.1	3.08e-155	7	414	6	413
QGY43648.1	5.19e-155	28	414	32	418
AHW59284.1	7.11e-155	28	414	31	417

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	1.17e-31	98	343	26	319	ChainA, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	3.09e-31	98	343	26	319	ChainA, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
3AMC_A	6.15e-13	101	339	34	288	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]
4LX4_A	6.83e-13	100	321	38	230	CrystalStructure Determination of Pseudomonas stutzeri endoglucanase Cel5A using a Twinned Data Set [Pseudomonas stutzeri A1501],4LX4_B Crystal Structure Determination of Pseudomonas stutzeri endoglucanase Cel5A using a Twinned Data Set [Pseudomonas stutzeri A1501],4LX4_C Crystal Structure Determination of Pseudomonas stutzeri endoglucanase Cel5A using a Twinned Data Set [Pseudomonas stutzeri A1501],4LX4_D Crystal Structure Determination of Pseudomonas stutzeri endoglucanase Cel5A using a Twinned Data Set [Pseudomonas stutzeri A1501],6R2J_A Crystal Structure of Pseudomonas stutzeri endoglucanase Cel5A in complex with cellobiose [Pseudomonas stutzeri A1501],6R2J_B Crystal Structure of Pseudomonas stutzeri endoglucanase Cel5A in complex with cellobiose [Pseudomonas stutzeri A1501],6R2J_C Crystal Structure of Pseudomonas stutzeri endoglucanase Cel5A in complex with cellobiose [Pseudomonas stutzeri A1501],6R2J_D Crystal Structure of Pseudomonas stutzeri endoglucanase Cel5A in complex with cellobiose [Pseudomonas stutzeri A1501]
3AMG_A	3.61e-12	101	339	34	288	Crystalstructures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8],3AMG_B Crystal structures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23340	2.42e-31	98	343	26	319	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
A3DJ77	2.42e-31	98	343	26	319	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
P0C2S3	8.86e-31	98	343	26	319	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
W8QRE4	8.55e-30	30	284	3	248	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
Q875R9	1.99e-14	48	340	48	406	Glucan 1,3-beta-glucosidase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / BCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) OX=226302 GN=EXG1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000003	1.000074	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001420_02737.