CAZyme Information: MGYG000001420_03020

Basic Information

• Species: Alistipes senegalensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes senegalensis
• CAZyme ID: MGYG000001420_03020
• CAZy Family: GH65
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
664	MGYG000001420_2|CGC18	73340.81	5.6975

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001420	3985129	Isolate	not provided	not provided

• Gene Location: Start: 1571512; End: 1573506 Strand: +

Full Sequence      

MMRLVFWVVLLSVVPLSVDARSEGWVITARDTTADYFAVAMANGEIGVAVGREPFALGSV
ILGGSYEPGFGDDVSRILEGINPLGLTMAVDGHRFDPSEVRPQHQSVDMRRAVHTTRFST
DGVTVVYRIRALRNMPYALMTEVEVTAERDAEVLFSNGHTVPGEFADTLRESRTVGCEDG
SRIAVQRTSGSYNRGRDHIVASSTFLCGEGCEAVSPESVRIVLRKGGRASFSLVGTICTT
AAFADPWNESERQAIYAAREGAAQLVAAHERKWAELWQGDIEIEGDPTAQLDVRFALFNL
YGSIREGSRRSIPPMGLSARGFYNGHIFWDSEIWMYPALLVLRPCLARQMLDYRTDGLDA
ARRRAYAHGYRGAMFPWEGDDRGEEATPTFALTGPLEHHITADIAIASWNYYCVTQDREW
LRREGFPLMREAARFWCDRVTANADGSYSIRNVIGANEYAVGVTDNAFTNGAACRALEYA
SAAAELCGERPDPQWSAVAAGLRIPHFADGTTREHAGYDGEMIKQADANLLGYPLGIVTG
REAQLRDLEYYERRIDPRNGPAMSYSVFAIQYARLGMAEKACEMFRRSYLPNLRPPFGVF
AETATSGNPYFMTGAGGMLQAVLFGFGGLEITADGLVQRPSVLPPQWKNLRIKINGKIYQ
ATNQ

Enzyme Prediction     

No EC number prediction in MGYG000001420_03020.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	294	633	1.6e-101	0.9946236559139785

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1554	ATH1	2.27e-105	40	655	31	723	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
pfam03632	Glyco_hydro_65m	2.88e-65	294	636	1	387	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
PRK13807	PRK13807	9.06e-39	257	655	283	712	maltose phosphorylase; Provisional
pfam03636	Glyco_hydro_65N	0.001	82	240	70	240	Glycosyl hydrolase family 65, N-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. This domain is believed to be essential for catalytic activity although its precise function remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFL77434.1	0.0	1	664	1	664
CBK63836.1	0.0	1	664	1	664
ADY37608.1	1.30e-237	25	657	27	665
QUT91743.1	3.19e-232	25	653	27	661
QRQ48989.1	6.85e-231	17	653	17	658

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7FE3_A	1.26e-169	20	652	19	664	ChainA, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_A Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101]
3WIQ_A	3.95e-52	260	654	273	718	Crystalstructure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
4KTP_A	1.82e-29	267	653	271	712	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTR_A	4.27e-29	267	653	271	712	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q54KX5	7.87e-79	262	663	251	658	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Dictyostelium discoideum OX=44689 GN=pgghg PE=3 SV=2
A0JMP0	1.73e-65	265	653	182	583	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Danio rerio OX=7955 GN=pgghg PE=2 SV=1
Q32M88	6.02e-62	265	661	227	631	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Homo sapiens OX=9606 GN=PGGHG PE=1 SV=2
F1NZI4	1.56e-59	249	641	216	624	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Gallus gallus OX=9031 GN=PGGHG PE=1 SV=3
Q8BP56	2.17e-57	265	659	226	628	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Mus musculus OX=10090 GN=Pgghg PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000236	0.999140	0.000173	0.000157	0.000149	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001420_03020.