CAZyme Information: MGYG000001422_00436

Basic Information

• Species: Bacteroides oleiciplenus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides oleiciplenus
• CAZyme ID: MGYG000001422_00436
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
798	MGYG000001422_1|CGC6	87742.99	4.6475

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001422	7071122	Isolate	not provided	Asia

• Gene Location: Start: 530026; End: 532422 Strand: -

Full Sequence      

MKIKFFLWYVFFGLLLMGCRDAESAIDHKQNVKVHLSMDVAVTRGTSVLPTAEGYHLRYV
LGVYKQNNGTLTLVQRMPQTTPDFNLQLAPDETFTLVAWADFVNSGVDNSALISVEDEFY
DTQSLKNVTIVKDKWTLNTPARDAFCGRIADVTSATSDITMALKRPFALLNVKGNYSDVS
SIKVTYPSVYTSYDALKGDITGTASQEILSGKTLSADANQILAFDYLFTHPLADGANYQE
GSILYDVNLDFFASNDATGNALKSFNIDYVPFTINYKTNLICPAENTTSVKVSCTIDADF
ATPDVDGNKPFIVSSYIRGNFYQKGDISTESMLACNDLIYMVVQPYGDGTLYFETPENNA
TFTGGVTHLDSYAGRNGVIAFDGTGEMNAGPHLMNTASAAMSAFSFATWIYIDEWTPDAV
LFSKTVGDSKVALQFGGVPEEMKFIVGSEISELTATGLLTGAWHYVGLSYSAKTVTLTID
ATKTADAVSNTGTMPFRAPTLLGSNFKGKLDETFFSGIKFDNPAAYKDKELTFKGDWNAT
KTLAYWKYDDASDKGKDSQTWVEIMKDIRSKLTGKNILFRLGVAGGNWKTMCASSVAIAD
FTRNMKNMMEQYDIDGADIDFEWPSSGADYTNVSNALIALKDGTENRVISPTLHPLYYKI
SAEAIAKMDWISIQCYGPSPDRYPVEQYKIDLQKVISDGGIPKEKIVAGLPFIGATNGKP
TQAYNTFTKNNLITSPDQNTVTYSGDEYLFDGQTNIKIKTRYARQQGMCGVMSWDLATDV
PFTNSLSLLKAMKEAAEE

Enzyme Prediction     

No EC number prediction in MGYG000001422_00436.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	543	781	4.5e-26	0.7905405405405406

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00704	Glyco_hydro_18	3.72e-19	563	779	52	307	Glycosyl hydrolases family 18.
smart00636	Glyco_18	5.28e-15	549	779	46	334	Glyco_18 domain.
cd06548	GH18_chitinase	3.00e-13	571	779	77	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
cd06545	GH18_3CO4_chitinase	2.21e-11	599	792	85	253	The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas.
cd00598	GH18_chitinase-like	8.56e-10	543	676	29	176	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBJ17915.1	1.95e-200	18	792	18	810
QQA10039.1	2.48e-132	283	794	32	543
QMW88601.1	2.48e-132	283	794	32	543
AAO76739.1	2.48e-132	283	794	32	543
ALJ40996.1	2.48e-132	283	794	32	543

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TSB_AAA	4.55e-09	572	779	84	337	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
6T9M_AAA	4.94e-09	572	779	103	356	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
4URI_A	5.15e-09	568	779	57	322	Crystalstructure of chitinase-like agglutinin RobpsCRA from Robinia pseudoacacia [Robinia pseudoacacia],4URI_B Crystal structure of chitinase-like agglutinin RobpsCRA from Robinia pseudoacacia [Robinia pseudoacacia]
3AQU_A	5.07e-06	581	779	71	330	Crystalstructure of a class V chitinase from Arabidopsis thaliana [Arabidopsis thaliana],3AQU_B Crystal structure of a class V chitinase from Arabidopsis thaliana [Arabidopsis thaliana],3AQU_C Crystal structure of a class V chitinase from Arabidopsis thaliana [Arabidopsis thaliana],3AQU_D Crystal structure of a class V chitinase from Arabidopsis thaliana [Arabidopsis thaliana]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000058	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001422_00436.