CAZyme Information: MGYG000001422_01479

Basic Information

• Species: Bacteroides oleiciplenus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides oleiciplenus
• CAZyme ID: MGYG000001422_01479
• CAZy Family: CE1
• CAZyme Description: Endo-1,4-beta-xylanase Z

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
293	MGYG000001422_1|CGC27	33583.52	6.8869

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001422	7071122	Isolate	not provided	Asia

• Gene Location: Start: 1680327; End: 1681208 Strand: -

Full Sequence      

MKKIIVWLVVVMCTLAGYAQNAPWNFQSKVVTDTLFSKVLNAKRAYTVFLPKSFEQNKEK
KYPVLYLLHGMWETNPVWTERGHVKDVMDRLVASGEACEMIIVTPNAGGNIHMEWNGYFD
MPGWKYETFFYTEFLPHIEKKYRVIGDKQHRAIAGLSMGGGGATNYGQRHSDMFCAVYAM
SALMSIPEQGAVSADDPNSKIAILTRSVIENSCVKYVMEADENRKADLRSVAWFVDCGDD
DFLLDRNIEFYQAMRNTGIPCQFRVRDGGHDWEYWHSALYQCLPFVTRIFGKE

Enzyme Prediction     

No EC number prediction in MGYG000001422_01479.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	37	288	1.2e-57	0.986784140969163

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	5.10e-29	45	293	36	315	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	5.15e-29	37	285	1	245	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2382	Fes	2.31e-21	17	283	51	292	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
COG4947	COG4947	1.92e-07	153	279	105	223	Esterase/lipase superfamily enzyme [General function prediction only].
COG0657	Aes	4.95e-07	30	290	50	311	Acetyl esterase/lipase [Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VTS04162.1	2.42e-32	29	288	60	293
VIP03395.1	2.42e-32	29	288	60	293
ABQ06889.1	3.15e-32	21	288	301	541
AIE83679.1	1.99e-31	16	292	36	282
QJW99051.1	6.73e-31	27	288	272	507

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VOL_A	4.92e-208	20	293	2	275	Bacint_04212ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_B Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_C Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_D Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_E Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_F Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_G Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_H Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393]
1JJF_A	3.56e-25	16	288	18	259	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	9.59e-25	16	288	18	259	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]
6RZN_A	2.78e-23	18	288	123	386	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_B	1.77e-19	43	289	131	345	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10478	4.69e-23	16	288	37	278	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EXZ4	3.26e-20	48	288	449	670	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P23553	5.48e-13	30	289	3	264	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1
D5EY13	6.49e-12	34	279	504	717	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P0C1D6	5.11e-10	21	293	97	389	Protein PS1 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=csp1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000218	0.999198	0.000151	0.000155	0.000141	0.000130

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001422_01479.