CAZyme Information: MGYG000001422_01481

Basic Information

• Species: Bacteroides oleiciplenus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides oleiciplenus
• CAZyme ID: MGYG000001422_01481
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
791	MGYG000001422_1|CGC27	90618.35	6.6963

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001422	7071122	Isolate	not provided	Asia

• Gene Location: Start: 1683311; End: 1685686 Strand: -

Full Sequence      

MNRKRALSVLFCLVSFLASTLAQDKLYTNTFPLGQVKLLEGPFKHACDLNVQILLQYDVD
RLLAPFLKEAGLQPKGESFPNWEGLDGHVGGHYLSALAIHYAATGNVDCKKRMEYMISEL
KRCQQKHADGYVGGVPDGMKVWNEIKKGNVGIVWKYWVPWYNLHKIYAGLRDAWIYGGNE
EARMMFLELCDWGMTIIAPLNDEQMEQMLANEFGGMDEVYADAYQMTGDMKYLNTAKRFS
HKWLLDSMAAQVDNLDNKHANTQVPKVVGYQRIAELGHDKKYEVATEYFWNTVVYNRSLS
LGGNSRREHFAAADDCKSYVEDREGPESCNTNNMLKLTEGLFRMHPEARYADFYERAMYN
HILSTQHPEHGGYVYFTSARPAHYRVYSAPNSAMWCCVGTGMENHGKYGEFIYTHAHDSL
FVNLFVASELNWKEKGITLIQETRFPDEESSRLTIRVKKPTKFKLLVRHPWWADGNDMKV
LCKGKDYASGSSPSSYIVIERTWKNGDVVDITTPMKVHIEALPNVSEYISIMRGPILLGA
RMGTDHLDGLIADDGRWAHIAHGPLVSAFDTPFIIGSREEIQSKLDNMKPVAGKAFCYTV
PGLFTEKYKDLVLEPFFRIHDSRYIMYWLAMTHEKYAEFQKAEQEKEQLKLLLDKRTVDA
VATAEQQPEVDHLMKYENSTTGTFEGETWRDARNGGYFQYNMMTGDESDLSLMVRYWGDE
TRNRTFDILIDDELLVTENLVGKWKRKELVNVEYPIPATMINGKKSVTVTFRSKPGNIAG
GVFYIRLLKKE

Enzyme Prediction     

No EC number prediction in MGYG000001422_01481.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	35	538	2.8e-199	0.9960238568588469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	7.63e-166	35	538	1	502	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.10e-106	36	546	12	508	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	7.11e-37	543	628	1	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37333.1	0.0	4	790	2	797
QCD36520.1	0.0	1	791	1	788
QUT88913.1	0.0	3	791	2	799
ALJ60078.1	0.0	9	791	6	799
QDO68314.1	0.0	3	791	2	799

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	4.20e-229	22	789	19	802	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	1.79e-222	22	789	19	802	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	1.42e-17	274	537	281	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	1.87e-17	224	537	203	543	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QK0_A	3.95e-16	273	537	279	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000202	0.999162	0.000153	0.000158	0.000147	0.000131

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001422_01481.