CAZyme Information: MGYG000001422_01546

Basic Information

• Species: Bacteroides oleiciplenus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides oleiciplenus
• CAZyme ID: MGYG000001422_01546
• CAZy Family: GH97
• CAZyme Description: Glucan 1,4-alpha-glucosidase SusB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
669	MGYG000001422_1|CGC30	75975.67	5.0612

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001422	7071122	Isolate	not provided	Asia

• Gene Location: Start: 1766196; End: 1768205 Strand: -

Full Sequence      

MKRYLIYTILSFLILASCTAPKPTEVASPDGHIRLVFVLDENSRMAYRVDVNDTTFIDPS
LLGFLAENGVNLSENFHLTGTDFTTQDEVWTQPWGENKTIRNHYNEMAVHLSDTAKTKLT
LRFRVFDDGLGFRYEYEVPGADSILVTDELTAFNIAQDGTSWSIPANYETYELLYRTQPV
SRIENANTPMTFKAGGVYASIHEAALTDFPEMTLKNAGDCNFKSELAPWPDGIKVRIAGG
SFKTPWRTIQIAPKAVGLINSGLILNLNEPCVLETTDWIRPMKYVGIWWGMHLGVESWVI
NDRHGATTENAKRYIDFAAANNIEAVMYEGWNEGWENWGGTQAFDYTKPYADFDMDEIAR
YAKEKGIEIIGHHETGGNIVNYEKQLDKAYKWYADLGIHSVKTGYAGGLPNGYNHHGQYN
VRHYRKVVETAAKYHTTLDVHEPIKDTGIRRTYPNMMTREGARGMEWNAWSEGNPPEHHV
MLPFTRLLAGPMDYTPGIFDIMYERAKKSPYRKKWNMMDSKDCRINTTLAKQIANWVILY
SPLQMAADMIENYEGHPAFQFFRDFDADCDWSEALAGEPGEFVVIVRKAKAKYFLGAATN
EEAREVDVKLDFLEKDRVYRAVIYADGTDTDWELNPTAYEIIEKLVTANDTLTINMARGG
GQAISFEPA

Enzyme Prediction     

No EC number prediction in MGYG000001422_01546.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	13	666	5.4e-232	0.9920760697305864

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	4.86e-144	276	565	2	277	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	4.72e-86	28	270	1	235	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	9.36e-38	569	666	1	96	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ61481.1	0.0	1	668	1	668
QUT92945.1	0.0	1	668	1	669
QDO69364.1	0.0	1	668	1	667
QUT77960.1	0.0	1	668	1	668
QUT56365.1	0.0	1	668	1	668

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HQ4_A	1.67e-191	26	667	3	659	AGlycoside Hydrolase Family 97 enzyme from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8],5HQA_A A Glycoside Hydrolase Family 97 enzyme in complex with Acarbose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQC_A	1.67e-191	26	667	3	659	AGlycoside Hydrolase Family 97 enzyme R171K variant from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQB_A	4.73e-191	26	667	3	659	AGlycoside Hydrolase Family 97 enzyme (E480Q) in complex with Panose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
3WFA_A	1.30e-159	25	667	4	704	Catalyticrole of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron],3WFA_B Catalytic role of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron]
2JKA_A	1.34e-159	25	667	13	713	Nativestructure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKA_B Native structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKE_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKE_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKP_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482],2JKP_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G8JZS4	1.63e-160	1	667	1	724	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1
Q8A6L0	2.12e-64	1	667	1	662	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
D7CFN7	4.95e-36	19	663	36	617	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000062	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001422_01546.