CAZyme Information: MGYG000001422_01798

Basic Information

• Species: Bacteroides oleiciplenus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides oleiciplenus
• CAZyme ID: MGYG000001422_01798
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
777		88783.34	6.9345

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001422	7071122	Isolate	not provided	Asia

• Gene Location: Start: 95427; End: 97760 Strand: -

Full Sequence      

MRAKYIIIFTIFLLVSQVVLAQEYEPVVKDVIAPKTKYFGIQDVRLLESPFLHAMNQNEQ
WMKELDLDRLLSNFRKNANLRPKAEPYDSWESMGIAGHTLGHLLTAMSQHYAATGDETFK
TKIDYVVNELDSCQMNFVNGFIGGMPGGDKVFKEVKKGIIRSMGFDLNGIWVPWYNEHKT
MMGLNDAYLLAGNETAKKVLINLSDYLADVIAPLNEEQMQTMLNCEYGGMNEAFAQVYAL
TGDEKYLDASYAFYHKRLQDKLAEGIDALQGLHSNTQIPKLIGSARQYELTGNQRDEKIA
RFSWETIVLHHSYANGGNSMGEYLSVPDKLSDRLGSNTCETCNTYNMLKLTGHLYEWTND
VQYLDYYERALYNHILASQHPETGNVCYFLSLGMGTHKGFGSRHNNFSCCMGSGFENHSK
YGGTIYSYVPGKEMININLYIPSVLTWKEKSLKLRMTTDYPEHGKIVIKLEETSKQSLTI
NLRRPAWATGDVVVRINGSKQKVGNTPGSFISLHHRWKKNDVIELILPMPLYTVSMPDNA
DRRAVFYGPTILAGTFGTEKRKMGDIPVFVSEEKSLTNYIKKISDTPINFVTTLPGGPDN
VKMLPFYKVADDNQTVYWDVYSPAEWQVVEEKRKAELERIAELDKMTTDYIVLGEMQPER
DHNLKGENTRNGEGYLRKYRFAYENGWFAFDMKCGYDQPMELLLTYYGGDSRKYTFDVLI
DDWVQPVSLTDATQGFVEHVVNIPLKVTKGKDKVRVMFRANDKTRVSNIYNCRLMKK

Enzyme Prediction     

No EC number prediction in MGYG000001422_01798.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	43	553	2.4e-195	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	9.38e-176	43	553	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.49e-113	47	628	14	583	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	2.75e-07	552	618	5	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.
cd04434	LanC_like	0.002	94	249	3	182	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.
PRK06107	PRK06107	0.003	208	273	257	318	aspartate transaminase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO67732.1	0.0	1	777	1	777
SNV45513.1	0.0	28	776	29	779
ADY34343.1	0.0	28	776	32	782
QEM13389.1	1.52e-237	27	776	28	778
QUT89366.1	2.75e-229	36	776	33	775

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	2.06e-166	35	776	24	802	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	5.34e-160	35	776	24	802	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000220	0.999186	0.000154	0.000151	0.000147	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001422_01798.