CAZyme Information: MGYG000001422_02318

Basic Information

• Species: Bacteroides oleiciplenus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides oleiciplenus
• CAZyme ID: MGYG000001422_02318
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
917	MGYG000001422_2|CGC19	104603.31	6.6704

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001422	7071122	Isolate	not provided	Asia

• Gene Location: Start: 857050; End: 859803 Strand: -

Full Sequence      

MKRYLMTFLAATVALYCVGAVFPSPSSDNSHDIASLHAWGPYSKRYAGISHIPDMRKGIR
FDFSVMPGYYRNRQLVPHVLFESSYYPWEINPEMTRITYRYELEWKDRVYTDVTYHILDD
NRTLVGIHCVNNTSMPQNLVLNQMAYIDYPETQPQVVATGASRLQWYNAIDYVENEPVRQ
SPQYRLVYDGWQRNEERSASSLDGSILGRGFGRNEGDRLAYLVNILPGHERGAIGLRFKV
KEGETAVLHLKGLTEQPVELRGTGEFSFLSVPYHCKKAGEYKLEFISASTVGISLDGFFV
GDSDEVSHVNVTPAPVPFTPMMEVGEDRKDFILKYKDCENFYGVAWNYQHSEVREILNGE
LESFFRRRVHDHVSSRLVGDRKWHYANTFLRPVVLEPNSEQTIYMLVCSGDKELVKQELS
GFHSAPDKLIAQIQPAKDAKFKDGVLPAGEKYLLGNRLLQASLLSNIVYPVYTQKEYIRH
FTPGKNWNSLYTWDSGFIALGLVDVDPAKAFECIKAYTTPVGSESAFIHHGTPLPIQMYA
YFDLWNNSLSHESLEFLYPRLKQYFDFMVGTDPYSTTRMEGSGLLRTWDYFYNSGGWDDY
PPQHELHRTKSQTPFVTPVVTSAYYLRAAKILRLAAKELGLKKDMKEYEQVIKQLSYALQ
TYAWDEESGYYGYVVHDSLGNAKDIFRYKDHSNFNKGLDGVTPLAAGICSSAQADKLVKH
LFSPDELWTKVGISTVDQSASYYKVDGYWNGAVWFPHQWMMWKALLDLGKGEEAYRVAHT
ALDNWEKECAESYFTFEHFIISSGRGAGWHQFSGLSSPILNWFAAYYKPGKVSTGFEVWI
TKSEFTGNCSGYKAEISFDDSTRPHERCMIVCMNAGCQYTVRFNGKPVKFRSGHAGMLEI
TLPATNKTGDLVVQALD

Enzyme Prediction     

No EC number prediction in MGYG000001422_02318.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	614	820	2.1e-17	0.4280701754385965

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3408	GDB1	2.19e-10	483	776	277	559	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
PRK10137	PRK10137	3.42e-10	619	786	578	744	alpha-glucosidase; Provisional
pfam03200	Glyco_hydro_63	3.45e-09	543	821	174	490	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
pfam17389	Bac_rhamnosid6H	4.41e-06	542	672	108	222	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
PRK13271	treA	4.47e-05	588	808	315	512	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBD73445.1	8.64e-15	596	793	339	523
ABW01842.1	6.33e-14	588	793	339	538
BAK81591.1	3.55e-11	622	784	556	713
QYE96607.1	1.73e-10	487	827	319	696
CEJ73885.1	2.28e-10	487	827	319	696

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XUX_A	3.44e-08	590	857	66	336	ChainA, Nanobody,Glucosidase YgjK,Glucosidase YgjK,Nanobody [Escherichia coli K-12]
7PQQ_B	3.44e-08	590	857	66	336	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]
7Q6Z_B	3.46e-08	590	857	88	358	ChainB, Megabody 177 [Escherichia coli K-12]
3W7S_A	4.22e-08	590	780	517	711	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7W_A	4.22e-08	590	780	517	711	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	2.34e-07	590	780	540	734	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.040682	0.951038	0.007311	0.000307	0.000308	0.000321

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001422_02318.