CAZyme Information: MGYG000001422_02350

Basic Information

• Species: Bacteroides oleiciplenus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides oleiciplenus
• CAZyme ID: MGYG000001422_02350
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
856	MGYG000001422_2|CGC20	98398.98	7.6601

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001422	7071122	Isolate	not provided	Asia

• Gene Location: Start: 920869; End: 923439 Strand: +

Full Sequence      

MNKIVPKKLSYKINVMHLRLFLLILVFNCFQFVKGNDFVWYSDNRPVTYCAPESLAPVVS
VAIDMFREDIQQVTGRLPQSVSIDDATIRIIQLDNTDIPIKDLQKRGVPVDKLASKRDAF
YITVSKRQLLVIGGDARGTAYGILELSRLAGVSPWVWWGDVTPEKKTKLILPAKYQTFQS
PSVEYRGIFLNDEDWSLQPWSWKNFEPSDIKGRIGARTYKEIFKLLMRLRANAIWPGMHG
ITTPFYFVPGAKEAADSCGILIGTSHCEPMMRNNVGEWKVNERGDYNYMTNREGVQSYWI
ERLKEAGPYENFYTMGMRGIHDSGMEGVKTLQEKTDVLQQVIDDQRKLLSKYVNKDVEKI
PQAFVPYKEVLQIMENGLQLPEDITLIWCDDNYGYMTRLSDEEQQKRSGGAGVYYHLSYW
GRPHDYMWLCTTQPGLIYNEMKQAYDCNARRLWVVNVHDLKPAAYDLELFLDMAWNINSV
SPSTLVEHQKNWLCREFGKEAGEKLLPAMLEFYRLCGIRKPEFMGWNQVELDKKKYTKGW
SPVKNTDFSLTEFGGELDRYLESYEAIKEILSEVEPMIPQERKDAFFAQIKYPVFGAAAM
STKILEAQRARCISPGSCDTTLWTRESQLMAACAKSIKAYQEIRNLTDYYNNELAGGKWK
YSMCHNPRDLYVFYPPKVPVWLTDKEIEKYASLKRTKSLPLAEAVKDSCIVSNACDYARA
SEGVMTIQSLGHSMNAVSVPKGKSITFEFDCLWDGEATLRTAVIPTQPNDKGDIRFSVSI
DGEKPQICSFKEGFRTEGWKQNVLRGQAIRATHHRLAKGKHTLSITALDDHVLIDQWMID
FKPDRMFYVFPVQPTY

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	36	837	1.2e-226	0.9971305595408895

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	4.67e-176	179	523	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	7.69e-15	716	851	32	170	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
cd14587	PTP-MTMR4	6.35e-04	659	701	3	47	protein tyrosine phosphatase-like domain of myotubularin related phosphoinositide phosphatase 4. Myotubularin related phosphoinositide phosphatase 4 (MTMR4), also known as FYVE domain-containing dual specificity protein phosphatase 2 (FYVE-DSP2) or zinc finger FYVE domain-containing protein 11 (ZFYVE11), is enzymatically active and contains a C-terminal FYVE domain and an N-terminal PH-GRAM domain. In general, myotubularins are a unique subgroup of protein tyrosine phosphatases that use inositol phospholipids, rather than phosphoproteins, as substrates. They dephosphorylate the D-3 position of phosphatidylinositol 3-phosphate [PI(3)P] and phosphatidylinositol 3,5-bisphosphate [PI(3,5)P2], generating phosphatidylinositol and phosphatidylinositol 5-phosphate [PI(5)P], respectively. MTMR4 localizes at the interface of early and recycling endosomes to regulate trafficking through this pathway. It plays a role in bacterial pathogenesis by stabilizing the integrity of bacteria-containing vacuoles.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EEB22662.1	0.0	31	856	35	860
QJR78604.1	0.0	31	856	35	860
AII65956.1	0.0	31	856	35	860
QJR53583.1	0.0	31	856	35	860
QJR61620.1	0.0	31	856	35	860

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5BY3_A	1.99e-214	36	836	18	770	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
4C90_A	3.97e-88	35	663	41	640	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
4ZMH_A	2.73e-84	67	840	43	919	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
7PUG_A	1.20e-80	30	841	9	821	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	5.88e-80	30	841	8	820	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000586	0.998761	0.000184	0.000150	0.000132	0.000132

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001422_02350.