CAZyme Information: MGYG000001422_02397

Basic Information

• Species: Bacteroides oleiciplenus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides oleiciplenus
• CAZyme ID: MGYG000001422_02397
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
524	MGYG000001422_2|CGC21	59956.95	8.1445

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001422	7071122	Isolate	not provided	Asia

• Gene Location: Start: 995649; End: 997223 Strand: +

Full Sequence      

MKKTILAAMLSGICSYAFAQPTTHFEIVAEQPLQVMEHFSASDAWSMHIIGKWPQEKQNQ
VADWLFSTENDANGKPKGIGLSLWRFNVGAGSTEQGKASQIGSPWMRTECFLQPDGNYDW
NKQQGQRNFLRLAKERGVNKFLAFLNSPPVYYTQNGLATNTGRDGTLNLKEEHYEDFARF
LANMIKGVEKKDGIKFDYLSPFNEPDGHWNWIGPKQEGTPATKKEIARAVRLISKEFVKE
GIDTKIAICEASDYRCMFATHMTDHERGYEIQSYFSPDSVDTYLGNTPKVLRLISGHSYW
TTTPLNMLRDYRRQLRDTLDKYKVDFWQTETCIMGNDEEIGGGHGFDCTMKTALYVARII
HHDIVYAGARSWQWWRAIGGDYKDGLIREYTDPDLRNGRVEDSKLMWILGNYSRFIRPGA
VRMSIRTTDRKGQVIPEGDTDQKGLMCSAYRNINGQWVMVVINYADKEQNFTFHVNDSKV
KSWQGYRTSDKVGEDLLPIDKLKKKQLAVIPARSVITFVSVVND

Enzyme Prediction     

EC	3.2.1.38

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	24	519	2.1e-196	0.9958677685950413

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	7.27e-148	25	387	4	366	O-Glycosyl hydrolase family 30.
COG5520	XynC	1.55e-15	119	519	97	427	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO68226.1	0.0	1	520	1	520
ALJ59968.1	0.0	1	520	1	520
QUT89019.1	0.0	1	520	1	520
QUT88786.1	0.0	1	520	1	520
ALJ60213.1	0.0	1	520	1	520

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	9.21e-95	25	524	8	500	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
6IUJ_A	1.38e-15	3	520	5	471	ChainA, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612],6IUJ_B Chain B, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612]
6KRL_A	4.00e-15	34	520	104	542	Crystalstructure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris [Saccharomyces uvarum],6KRN_A Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris in complex with aldotriuronic acid [Saccharomyces uvarum]
6M5Z_A	4.71e-11	4	519	9	452	ChainA, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
7O0E_A	8.21e-11	34	463	14	386	ChainA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q76FP5	7.52e-14	37	260	36	266	Endo-beta-1,6-galactanase OS=Hypocrea rufa OX=5547 GN=6GAL PE=1 SV=1
G2Q1N4	5.02e-11	1	463	1	410	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001655	0.965809	0.031645	0.000319	0.000264	0.000245

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001422_02397.