CAZyme Information: MGYG000001422_03057

Basic Information

• Species: Bacteroides oleiciplenus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides oleiciplenus
• CAZyme ID: MGYG000001422_03057
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1003	MGYG000001422_3|CGC4	115091.63	6.9222

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001422	7071122	Isolate	not provided	Asia

• Gene Location: Start: 334956; End: 337967 Strand: -

Full Sequence      

MKKKVLLLFWTILCISHYAVASNNDVRHKYNFNSDWLLSVGDANGAEQQKYTDNSWKKVT
LPHAFNEDEAFRYSIDELTDTIVWYRKHFRLPAGSEGKKIFIEFEGVRQAADFYINGKHI
GLHENGVMAVGFDLTPYISYNKENVIALRIDNNWQYKERGTNTRFQWNDRNFNANYGGLP
KNVWLHLTDKLYQTLPLYSNLKTTGVYIYAENIRVKSRKAVIHAESEIKNEYRKKQQVAY
QVEIQDREGKIVKTMSGESITLQPGETAVVKASAEVDNLHFWSWGYGYLYTVKTSLWIDG
KKTDEVATRTGFRKTRFGNGKIWLNDRVLQMKGFAQRTSNEWPALGLSVPAWLSDYSNGL
MVECNANLVRWMHVTPWKQDIESCDRVGLIQAMPAGDSEKDRQGRQWEQRTELMRDAIIY
NRNNPSILFYESGNESISREHMLEMKAIRDKYDPYGGRAIGSREMLDIREAEYGGEMLYI
NKSAHHPMWATEYCRDEALRKYWDNYSYPYHKHGEGSKAYKSTVTNKVQKQVDARAYNQN
QDSFAIENIRRWYDYWRERPGTGFRVSSGGVKIIFSDSNTHFRGVENYRRSGATDAMRIP
KDLFYALQTMWDGWVDTENPRIHIIGHWNYEESIIKPVHVVSSADSVALFLNGKSLGESI
QEYHFLHTYNDVKFEAGKLEAVGYDQNGKECCRTELQTAGKPERILLNLMQNPAGWKADG
ADVVMVQVEVVDKDGRRCPLANDLISFEMEGPAEWRGGIAQGENNYILSQKLPVECGVNR
VLIRSLTEAGKVHLKASAAGLQSAEINFTSLPIEVKNGLSQYIPSNELQGRLTRGETPQT
PSYTDKKVAVFIESVKAGTNNETATNSYDDNELSEWKNDGKASTAWITYRLNRPARVDEI
CMKLTGWRMRSYPLEIYAGEELIWSGDTEKSLGYIHLNVKPVLTQEITIRLKGSSSEEDA
FGQIVEVAAPVANELDLYKSDESKRAKYELRIVEIEFLENLLQ

Enzyme Prediction     

EC	3.2.1.31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	21	492	6e-64	0.49601063829787234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	5.39e-28	32	468	15	444	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	5.19e-26	27	454	10	431	beta-D-glucuronidase; Provisional
pfam16355	DUF4982	1.04e-15	635	694	3	62	Domain of unknown function (DUF4982). This family is found in the C-terminal of uncharacterized proteins and beta-galactosidases around 680 residues in length from various Bacteroides species. The function of this protein is unknown.
pfam18565	Glyco_hydro2_C5	8.16e-15	716	806	10	102	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
pfam00703	Glyco_hydro_2	4.96e-14	206	313	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO69323.1	0.0	1	1003	1	1001
ALJ39996.1	0.0	1	1003	1	1001
AAO77786.1	0.0	1	1003	1	1001
QMW85119.1	0.0	1	1003	1	1001
QQA09137.1	0.0	1	1003	1	1001

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPD_A	3.76e-166	1	843	1	840	Thestructure of a beta-glucuronidase from glycoside hydrolase family 2 [Formosa agariphila KMM 3901]
7CWD_A	7.62e-63	29	806	3	797	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
5T98_A	4.26e-61	31	815	29	822	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
4YPJ_A	2.50e-59	25	812	5	810	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
4CUC_A	3.36e-45	29	806	15	840	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA. [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KN75	2.27e-165	27	843	26	831	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
A7LXS9	1.19e-54	27	810	42	848	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	8.58e-49	12	857	34	871	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
P77989	3.18e-48	27	798	3	725	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KPJ7	3.29e-30	3	689	28	710	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000523	0.998484	0.000377	0.000196	0.000203	0.000190

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001422_03057.