CAZyme Information: MGYG000001422_04400

Basic Information

• Species: Bacteroides oleiciplenus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides oleiciplenus
• CAZyme ID: MGYG000001422_04400
• CAZy Family: PL10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	MGYG000001422_5|CGC7	42302.33	6.815

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001422	7071122	Isolate	not provided	Asia

• Gene Location: Start: 428018; End: 429115 Strand: +

Full Sequence      

MKKICLCCLALLCLTNVFAQETVNYKEKKSYKTWVKMAPKLDDEFFKTTEAIRIGDNVLL
YQQTTGGWPKNIYMPAELTEQEREDVLASKDDVNESTIDNDATSTEIEYLSRLYLATNTE
KYKDAALDGIRYILKAQYPNGGWPQFWPRPKGYYTHITYNDNAMVNVMELLRQIYEKKAP
YTYVPDSICDHARTAFDKGVECILKTQVIINGKPTVWCAQHDEHTLAPAKARAYELPSLS
GAESDNIVILLMSLPNPSKEVIACIENAIEWFKISKIEGMKKEFFTNDEGKKDFRMVPCT
DCPPLWGRFYTLEDNRPFVSDRDGVKKFDISEIGYERRNGYSWYNSDGLKVFKKYEQWKK
KNNRL

Enzyme Prediction     

No EC number prediction in MGYG000001422_04400.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL10	62	349	2.6e-117	0.9895833333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09492	Pec_lyase	9.23e-159	62	352	1	289	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.
TIGR02474	pec_lyase	1.86e-146	62	351	1	289	pectate lyase, PelA/Pel-15E family. Members of this family are isozymes of pectate lyase (EC 4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO69049.1	6.68e-261	1	364	1	364
ALJ61046.1	2.59e-256	1	362	1	362
QUT93421.1	2.13e-255	1	362	1	362
QRQ48738.1	4.00e-208	1	361	1	365
QUT45489.1	4.00e-208	1	361	1	365

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R76_A	9.54e-66	48	362	79	408	ChainA, pectate lyase [Niveispirillum irakense]
1GXM_A	7.28e-58	56	351	38	322	Family10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXM_B Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXN_A Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus]
1GXO_A	1.12e-56	56	351	38	322	MutantD189A of Family 10 polysaccharide lyase from Cellvibrio cellulosa in complex with trigalaturonic acid [Cellvibrio japonicus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000223	0.999103	0.000195	0.000147	0.000145	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001422_04400.