CAZyme Information: MGYG000001422_04496

Basic Information

• Species: Bacteroides oleiciplenus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides oleiciplenus
• CAZyme ID: MGYG000001422_04496
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
637	MGYG000001422_5|CGC9	73620	6.8103

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001422	7071122	Isolate	not provided	Asia

• Gene Location: Start: 585505; End: 587418 Strand: -

Full Sequence      

MKKHLLIGLFLVGLFIYPIKVISGNTPEELYESLQKRLASGWNTWDTRSVLTHVFLPYGF
AVDLNMMDTDGSRVRKFRIGDRAKEAPLLQPGPHSFDGAYTKMTIDWRGYKLQVESAAMG
LKNIILIRPLTETKKGGRLVVIPESLWKRGNTLSVDSLGFTLASRDKVVEIKTYIEGELL
EKKGREFILSLDTPVAICCGENMGLDDAIAFINNRARDFINSNQKQFGANYDCYNAMQSV
LAWDNIYDPGIRRVITPVSRIWSSEWFASEDFGGFTLFCWDTYFASMMLAVGNKELAYAN
AVEITKAITERGFVPNCFYSNNFKSRDRSQPPVGSLAVWTIYKQYQEKWFLELLYKELLT
WNRWWSQNREDRGLLCLGSNPYEKVTYFRSEFDTDCHYGAVLESGLDNSPMYDGVPFNKQ
KHLLEQHDVGMSSLYIMDCDYLALIAEELGYKKDVTELRKRAEYYRNNLAGLWDDKTGFY
YNRSTRDLKFNYRTSPTCFYPLLAKVPTQSQAERMIKEHLLDTDEFWGEYIIPSVPKNDP
AFKDNEYWRGRIWAPLNFLVYLGLNNYEFPEVRHAFAEKSQKLLLKSWLSHGYVFENYNA
LTGEGDDVVRSDKFYHWGALLGYISLMENGVVSKCCK

Enzyme Prediction     

No EC number prediction in MGYG000001422_04496.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	274	621	6.7e-30	0.3543859649122807

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	4.53e-22	272	604	342	762	alpha-glucosidase; Provisional
pfam03200	Glyco_hydro_63	2.64e-10	350	621	187	488	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
pfam01204	Trehalase	1.00e-08	261	603	107	478	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG3408	GDB1	6.61e-07	266	603	272	583	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
COG1626	TreA	1.81e-06	277	606	172	525	Neutral trehalase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO68990.1	0.0	1	635	1	635
QRQ47302.1	0.0	1	634	1	634
QUT46474.1	0.0	1	634	1	634
ANH81205.1	2.24e-263	22	630	21	634
QNK58860.1	4.34e-177	31	630	18	616

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	1.23e-12	272	603	315	734	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	4.88e-12	272	603	315	734	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	6.43e-12	272	603	315	734	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	1.02e-10	272	603	316	735	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	6.77e-09	424	603	95	283	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	6.84e-12	272	603	338	757	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
P53008	8.20e-08	503	621	697	826	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
P52494	5.76e-07	472	603	704	838	Cytosolic neutral trehalase OS=Candida albicans OX=5476 GN=NTC1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000657	0.998454	0.000298	0.000179	0.000186	0.000194

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001422_04496.