CAZyme Information: MGYG000001422_05066

Basic Information

• Species: Bacteroides oleiciplenus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides oleiciplenus
• CAZyme ID: MGYG000001422_05066
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
891	MGYG000001422_7|CGC1	101269.53	6.7337

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001422	7071122	Isolate	not provided	Asia

• Gene Location: Start: 16973; End: 19648 Strand: +

Full Sequence      

MKRILSVFFFISLFHLSLLAGSIGKLNVLRCEYLVAPLGIDVPSPRLSWQLPVDVDVQEA
YQVIVGTDSVRVAQGMGDSWNSGKQTISNVLTVYAGQKLQPYTRYYWKVCVWDSNKMYTS
DVTYFETGVMDEHNWKGNWISDTHNIHLKPAAYFRKEWDAKRTIREARAYIAVAGLYELY
INGSRVGDHRLDPAYTRFDRRTLYLTHDVTQLLKQGNNAIGVLLGNGWYNHQSTAVWNFD
QAPWRGRPKFCMDIRVVYDDGKVEFISTGQDWKTSLSPVIFNSIYTAEHYDARLEQPDWN
TPGFDDKKWKNASCTSAPSPLIVSQQMHPIRDVEMLRPAKMIKLSDSIYLFDLGRNIAGV
SQLTIKGKPGTEVRLKHSERIGEDNRADMSNIDYHYRPTDDSDPFQTDIFILSGTGEETF
RARFNYKGFQYVEVTSSEPVELTDNSLKAYFMHSDVPVAGRISSSDELLNKIWKATNAAY
LSNLFGYPTDCPQREKNGWTGDAHIAIETGLYNYDGITVYEKWMADHQDEQAPNGVLPAI
IPTAGWGYHWGNGVDWTSTVAIIPWNIYLFYGDKHLLESMYDNIRRYVDYLNYTYPSGIT
DWGLGDWIPIKSHSSKELTSSIYYYVDTDILAKAARILNKQQDYEKYSALAQKIKNSINA
RFLNEETGIYCGGSQTELSAPLYWGIVPEHLKELVVYNLAEKVSKDGSMDVGLLGSKTIL
NALSVNGYADLAYQLASKETYPSWGWWIKNGATTLYENWRIDGKKDISLNHIMFGEISAW
YYKALGGLYPDSSMPGFKHIILRPNFVAGLDAFEASHISPYGEIVSSWKKNRGKVQYTIT
IPSNSSATLYLNEAYKIECKEINAATLSAMRKKGGGIELLTGIYHFEIKTK

Enzyme Prediction     

No EC number prediction in MGYG000001422_05066.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	343	851	4e-151	0.9940476190476191
CBM67	138	315	1.8e-39	0.9431818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.89e-117	459	785	3	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.39e-71	164	334	3	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.02e-28	342	453	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	4.94e-20	787	851	1	63	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
PRK10137	PRK10137	0.003	623	670	583	630	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE48069.1	0.0	15	880	14	889
AHM58389.1	0.0	30	889	54	932
QGY42770.1	0.0	1	889	1	897
QMW03094.1	0.0	29	889	32	877
BBD46125.1	0.0	1	889	1	898

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	6.86e-171	29	856	35	903	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	3.73e-111	32	851	12	994	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	6.32e-96	38	851	16	846	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	1.02e-135	37	879	43	933	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
P9WF03	4.91e-121	32	888	38	910	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KNB2	5.63e-121	37	889	47	923	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	1.60e-110	32	851	12	994	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.298661	0.691276	0.008449	0.000541	0.000377	0.000689

TMHMM  Annotations     

start	end
5	24