CAZyme Information: MGYG000001422_05081

Basic Information

• Species: Bacteroides oleiciplenus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides oleiciplenus
• CAZyme ID: MGYG000001422_05081
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
935	MGYG000001422_7|CGC1	106805.22	6.3924

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001422	7071122	Isolate	not provided	Asia

• Gene Location: Start: 46442; End: 49249 Strand: -

Full Sequence      

MKYYFTLAILLQFFLSSYAQRIDLSGIWRFAIDKEEVGITSQWYLQTLKDQVKLPGSMLT
NGKGDPVNIQTPWTGTLSDMAFFEQDKYERYRKEDNIKVPFWLQPDKYYTGVAWYQRDID
IPETWKDKVIRLFFERCHWESRVWIDGVEVGMRNALSAPQEYDLTDYLKPGKHRISVRVD
NKVRDIDPGENSHSISDHTQGNWNGIAGAMYLEAKSRIFYEHVDVYPSLADRKLTLKLNV
HNGEAKKKKVDLIFHLEGTEVIEQHTMQPGDNKLELVLPLPESVAYWDEFHPNLYTLKYA
LRANKKELDSRQLTFGCRDWSVKEGKLQLNGHPAFMRGTLHCAAFPLTGYPATDKAEWLR
EFRICKEYGINHIRFHSWCPPEAAFEAADELGLYCQVECSSWPNQSSSIGEGKPVDAFLL
AEAGHIVKAYGNHPSFCMLAHGNEPRGKNHKEYLADFVSYWKAHDVRRLYTSSAGWPNLP
ENEFLSDSEPRIQHWGEGLGSIINSKAPSTAYDWSSYTSKFSQPFISHEIGQWCVYPNFR
EMKKYTGVYHPKNFEIFQESLIENGLRALADSFLIASGKLQTLCYKADIEAALRTPGFGG
FQLLGLNDFPGQGTALVGTLDAFWEEKGYVTAEEYRRFCNSIVPLARMPRLIFENNEKFA
AQVEVANYKEELLQPDIQWTVKDKQGNVVKQGAFSVARLPIGNCLKIGDIQFHLNHVTQA
CQLNLEVSVGGYCNDWDFWVYPAQKEAFDDSDILLTDCLDEATLKHLNKGGKALLSLKKG
TLAKEFGGDIAIGFSSIFWNTSWTEGQAPHTLGLLCNPEHPALALFPTDFYSNYQWWDAM
SHSGSIQIGKLSKDIQPIVRVIDDWFTNRSLALLFEVKVGSGKLLVSGIDFHQDMDKRQS
ARQLLYSLKRYMQSASFCPEISMDTEMINSLISKK

Enzyme Prediction     

No EC number prediction in MGYG000001422_05081.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	18	695	5.5e-76	0.675531914893617

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.66e-27	18	451	9	414	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	3.54e-22	20	468	11	443	beta-D-glucuronidase; Provisional
PRK10340	ebgA	1.76e-17	97	444	99	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02837	Glyco_hydro_2_N	1.36e-16	24	212	4	165	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
pfam00703	Glyco_hydro_2	5.69e-11	221	318	4	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AII65944.1	0.0	58	934	1	876
BBE19496.1	0.0	20	931	25	941
AKA51553.1	0.0	16	935	17	928
QRP90536.1	0.0	16	935	17	928
BAC56907.2	0.0	16	935	17	928

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	2.17e-24	22	444	39	440	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	2.17e-24	22	444	40	441	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3GM8_A	7.37e-20	111	471	66	422	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
5T98_A	4.95e-16	109	456	82	436	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
7KGY_A	3.06e-14	22	487	18	425	ChainA, Beta-glucuronidase [Faecalibacterium prausnitzii],7KGY_B Chain B, Beta-glucuronidase [Faecalibacterium prausnitzii],7KGY_C Chain C, Beta-glucuronidase [Faecalibacterium prausnitzii],7KGY_D Chain D, Beta-glucuronidase [Faecalibacterium prausnitzii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	1.19e-23	22	444	40	441	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
T2KM09	5.31e-22	25	529	37	492	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KPJ7	9.48e-19	108	444	100	430	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P24131	1.58e-17	23	469	48	481	Beta-galactosidase OS=Clostridium acetobutylicum OX=1488 GN=cbgA PE=2 SV=2
P23989	2.03e-16	21	529	45	546	Beta-galactosidase OS=Streptococcus thermophilus OX=1308 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000415	0.998801	0.000297	0.000164	0.000158	0.000154

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001422_05081.