CAZyme Information: MGYG000001422_05164

Basic Information

• Species: Bacteroides oleiciplenus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides oleiciplenus
• CAZyme ID: MGYG000001422_05164
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256	MGYG000001422_7|CGC3	28557.07	8.4292

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001422	7071122	Isolate	not provided	Asia

• Gene Location: Start: 176877; End: 177647 Strand: +

Full Sequence      

MKRIISVVCVLFSLLSLSAQETYQKETFISSRGDTLPYRLLLPETAKAGEKYPLVLFLHG
AGERGNDNERQLTHGGQMFLNPVNREKYPAFVLVPQCPVAGYWAYMERPASFMPGEMPLD
NPLTPVFQTVKDLLDTYLAMPQVDKNRIYIIGLSMGGMGTFDMAIRYPEIFAAAVPVCGT
VNPARLKAAKQVKFRIFHGDADNVVTPEGSRAAYKALKAAGADVEYIEFPGCNHGSWNPA
FNYPGFMEWIFSQKKK

Enzyme Prediction     

No EC number prediction in MGYG000001422_05164.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	33	236	2.8e-30	0.8942731277533039

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4099	COG4099	1.25e-50	14	254	157	386	Predicted peptidase [General function prediction only].
COG1506	DAP2	1.19e-18	27	235	369	595	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
COG0412	DLH	3.70e-14	25	243	3	210	Dienelactone hydrolase [Secondary metabolites biosynthesis, transport and catabolism].
COG0400	YpfH	4.31e-14	38	231	8	186	Predicted esterase [General function prediction only].
pfam02230	Abhydrolase_2	9.56e-12	46	238	8	203	Phospholipase/Carboxylesterase. This family consists of both phospholipases and carboxylesterases with broad substrate specificity, and is structurally related to alpha/beta hydrolases pfam00561.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABS60377.1	2.86e-51	36	256	22	246
BCI61582.1	6.03e-47	18	254	806	1042
QJW99051.1	3.99e-36	23	255	34	240
VTR91196.1	5.36e-33	36	255	43	239
ACR12533.1	7.31e-33	17	254	42	280

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DOH_A	1.28e-50	33	255	155	380	CrystalStructure of a Thermostable Esterase [Thermotoga maritima],3DOH_B Crystal Structure of a Thermostable Esterase [Thermotoga maritima],3DOI_A Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima],3DOI_B Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima]
3WYD_A	5.23e-30	32	256	17	218	C-terminalesterase domain of LC-Est1 [uncultured organism],3WYD_B C-terminal esterase domain of LC-Est1 [uncultured organism]
4Q82_A	1.81e-11	50	255	78	277	CrystalStructure of Phospholipase/Carboxylesterase from Haliangium ochraceum [Haliangium ochraceum DSM 14365],4Q82_B Crystal Structure of Phospholipase/Carboxylesterase from Haliangium ochraceum [Haliangium ochraceum DSM 14365]
7JIZ_A	1.04e-07	134	246	112	228	ChainA, Dienelactone hydrolase family protein [Solimonas sp. K1W22B-7],7JIZ_B Chain B, Dienelactone hydrolase family protein [Solimonas sp. K1W22B-7]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0J969	1.67e-10	43	234	42	240	Probable carboxylesterase Os04g0669500 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0669500 PE=3 SV=1
D5EY13	2.82e-06	50	234	533	708	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000360	0.998869	0.000262	0.000163	0.000158	0.000155

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001422_05164.