CAZyme Information: MGYG000001422_05405

Basic Information

• Species: Bacteroides oleiciplenus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides oleiciplenus
• CAZyme ID: MGYG000001422_05405
• CAZy Family: GH84
• CAZyme Description: O-GlcNAcase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
756		86224.64	6.1599

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001422	7071122	Isolate	not provided	Asia

• Gene Location: Start: 72756; End: 75026 Strand: +

Full Sequence      

MYNHINHGNEPSLLLLMKNKKISLLGAGLLCAAALFAQDMSLQPSPQEFITRDSNISLPA
IYQIDGEKEANPHAVKVLKDLLAGKQSTREGLRIYIGEKGDKSVRKYSRLIPDHDEGYYL
SVNEKEIVLAGADERGTYYALQTFAQLIKDGRLPEVEIKDYPSVRRRGVVEGFYGTPWSH
RARLSQLEFYGKNKMNTYIYGPKDDPYHSAPNWRLPYPEKEATQLQELVTVANENEVDFV
WAIHPGQDIKWNPEDRNLLLSKFEKMYQLGVRSFAVFFDDISGEGTNPQKQAELLNYIDE
HFVQTKPDVNPLIMCPTEYNKSWSNPNGNYLTTLGEQLNPSIQIMWTGDRVVSDITRDGI
TWINERIKRPAYIWWNFPVSDYVRDHLLLGPVYGNDTTIANAMSGFVTNPMEHAEASKIA
IYSVASYAWNPAKYDAMQTWKDAIHAILPDAAEELECFATHNADLGVNGHKYRREESQDI
QPVAERFLKSYINNGSYDKEDIEALQKTFEQMKESADILLANKENKPLITEITPWLHQFK
LLAETGEAVLKMVESRESGSHSDFIRKYKHVKALQQLMFDVDQTYNQNPYQPGVKTATKV
IKPLIDQTFATVTKRYNQKNGTQLDATADYMPHRLISNVEQIKNLPLQVKANRILISPAN
EVVKWAAGNSVEIELDNAYPGESIQINFGKDIPCTWGHLEISTDGKEWKSINLKQKESRL
TADLQNTPVKFIRFTNVSAEEQQVYLRQFVLTIVKG

Enzyme Prediction     

No EC number prediction in MGYG000001422_05405.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	167	459	3.3e-118	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	7.49e-179	167	458	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam18344	CBM32	1.61e-28	624	687	1	64	Carbohydrate binding module family 32. This domain is found in GH84C present in Clostridium perfringens. GH84C is a beta-N-acetylglucosaminidase. This domain is a family 32 carbohydrate binding module (CBM) which preferentially recognizes the non-reducing terminus of N-acetyllactosamine.
pfam02838	Glyco_hydro_20b	1.70e-16	39	160	1	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
COG3525	Chb	4.90e-04	42	169	136	266	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU94781.1	0.0	17	756	1	740
QUT42280.1	0.0	17	755	1	736
QUT70077.1	0.0	17	755	1	736
BCA48935.1	0.0	17	755	1	736
QMW86728.1	0.0	17	755	1	736

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WZI_A	0.0	17	755	1	736	BtGH84D243N in complex with 5F-oxazoline [Bacteroides thetaiotaomicron VPI-5482],2WZI_B BtGH84 D243N in complex with 5F-oxazoline [Bacteroides thetaiotaomicron VPI-5482]
2VVN_A	0.0	17	755	1	736	BtGH84in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVN_B BtGH84 in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVS_A BtGH84 structure in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],2X0H_A BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],2X0H_B BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],4AIS_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],4AIS_B A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],7OU8_AAA Chain AAA, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482],7OU8_BBB Chain BBB, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482]
2WZH_A	0.0	17	755	1	736	BtGH84D242N in complex with MeUMB-derived oxazoline [Bacteroides thetaiotaomicron VPI-5482],4AIU_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482]
5MI4_A	0.0	39	755	13	726	BtGH84mutant with covalent modification by MA3 [Bacteroides thetaiotaomicron VPI-5482],5MI5_A BtGH84 mutant with covalent modification by MA3 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],5MI6_A BtGH84 mutant with covalent modification by MA3 in complex with Thiamet G [Bacteroides thetaiotaomicron VPI-5482],5MI7_A BtGH84 mutant with covalent modification by MA4 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482]
5ABF_B	0.0	50	755	23	725	Structureof GH84 with ligand [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	0.0	17	755	1	736	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q0TR53	6.26e-111	41	740	45	737	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	6.26e-111	41	740	45	737	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
P26831	3.75e-57	43	585	56	622	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
O60502	2.39e-44	168	427	63	331	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.037783	0.958678	0.002755	0.000277	0.000239	0.000241

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001422_05405.