CAZyme Information: MGYG000001423_00483

Basic Information

• Species: Clostridium celatum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium celatum
• CAZyme ID: MGYG000001423_00483
• CAZy Family: GH101
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1564		175004.46	4.4324

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001423	3553421	Isolate	not provided	not provided

• Gene Location: Start: 10023; End: 14717 Strand: -

Full Sequence      

MTLNNSAGRSAILFRYESPSSFAGIAYDTNGAWVWLSEGSYGTLPFTKVLEPGTEYKINI
KYVGTHITIVIDDEVMYQGEISGIKTTAGRIGTRNWGWTGNYGSSTFDYFKNGKFSSVTL
DSDYKYVLYNEAGTYDIPITLTGDNTLSKLTVGGNTLVEGEDYILTDNILVIKKEYIEKV
KEGGTTNINIIFEDGYLTTFKLQVQLPPDEAASYIRDFSTDGIGGLSVIKGSGSAELQED
KLLFKSDGNSILIDENSPELFNSSVEFVVDPLTDAANIGAIVRYSEDDNSWTYIGQDGSG
NQYGSYWYVENSNGQRRALVQDTARIYANRVKPYKIKVKVVENAVSIYLDGAEIYNGVVP
ELTSKKGKAGIRLGGNNSGKYQYLSVESEEVLSTNVNEVTEKEISSNDLTVKMDASFPRV
IDYTLNDKKLYGQEKPIYYISINNKNYVPKVTSEFNGNEAVYHLYVEELGVTLDTRFTVE
NNVLTMNIENVDESITRVDTINFPNHSLVSVRSNQTNAEFNGADYENDDVKINLTSKRED
TTYSNTNIAILSCDDLAASITSNSIKLRDQINYQTVSVDDYYSTGLWPNEYLYRGIDGEL
INEPYAKVTITDDRNKDNSVDYQDGAIALRDDIQENRLGSELVNQTYSSVAMNVGSTAHY
PFLRILDNIKKFNLATDGFGQTIIIKGYQSEGHDSSHPDFANISNRLGGEEAFRILLEES
DKYNANIGVHINHTEAYPEAPQYGSNIVSTVGGWSWYDDSKQIIRENDIMNEESGMGARL
EELIEKAPGLDMIYVDVYMDTRWPAYKLTSKLNDLGIAVASEYAKQLGTTSVWAHHAYNG
GYGTSSELARFVNHQEQDVFGGTNLFRGNSRQGINGWQGESNLNTTVSNFFTSQLPFKYL
MNFPISIWEDNQITFGENNEVVSKMDNGVNVITQDGKEVARGNKIFIPWTIDNEEKIYHW
NDSNSSTTWDLPNSWAGLETVYLYELSDEGKINETVVNVVNNKVTLEVKKNAGYVVYKGE
KAQEKMEWSTGSLVKDMGFDSHSFEYWNKSSNGKSTDHIEVVNNSKGNTHIKVSGTDDAL
ISQTITGLEPGQTYSASAWFEVSDGRRGTLSILTSDGKEVSEYIDRCNVKYGHTHSDKTN
SYYQRVRVNFTVPEDSTTATIQLKAAEGAAGSFVNMDDVLVMKIGVSDKQGHDFFEDYEN
VDFGYGPFISTSSDHSHLSETNAPYTNDTIEGRYSLKIRNGNYMRTIPSTMRLKPNTTYR
VGFDYISYAEQGFIAAIKSDKASEAGDTANAVLKTADLNTGTNQAVLEFTTGNYDDYYLD
LTKQNNNNLIVDNVFVDEIVNISIDTLVELVNELKALDESAYTTESLNSLKDKIKDAETV
INKANATEDEVKNAYNELTKAKEALVRYATVAEVNDLKATIEEMKAINSNDYKQNDKWTV
FQEKIVEAEKLVKENKITVIQITSIKSELYKAKSELTKVDSADKANIEALLLEAQSAKEE
DYAQNTAWQDFKQDITEAVAIIANESATQEEVDYRYNKLKESYDSIVPTNKTFIKHFSRT
SRWI

Enzyme Prediction     

No EC number prediction in MGYG000001423_00483.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH101	406	1018	3.3e-133	0.9971711456859972

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14244	GH_101_like	5.74e-87	641	910	6	298	Endo-a-N-acetylgalactosaminidase and related glcyosyl hydrolases. This family contains the enzymatically active domain of cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins (EC:3.2.1.97). It has been classified as glycosyl hydrolase family 101 in the Cazy resource. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae and other commensal human bacteria is largely determined by their ability to degrade host glycoproteins and to metabolize the resultant carbohydrates.
pfam12905	Glyco_hydro_101	1.95e-74	623	885	1	271	Endo-alpha-N-acetylgalactosaminidase. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae is largely determined by the ability to degrade host glycoproteins and to metabolize the resultant carbohydrates. This family is the enzymatic region, EC:3.2.1.97, of the cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins. This reaction is exemplified by the S. pneumoniae protein Endo-alpha-N-acetylgalactosaminidase, where Asp764 is the catalytic nucleophile-base and Glu796 the catalytic proton donor.
pfam18080	Gal_mutarotas_3	2.88e-61	404	622	1	243	Galactose mutarotase-like fold domain. This domain is found in endo-alpha-N-acetylgalactosaminidase present in Streptococcus pneumoniae. Endo-alpha-N-acetylgalactosaminidase is a cell surface-anchored glycoside hydrolase involved in the breakdown of mucin type O-linked glycans. The domain, known as domain 2, exhibits strong structural similarlity to the galactose mutarotase-like fold but lacks the active site residues. Domains, found in a number of glycoside hydrolases, structurally similar to domain 2 confer stability to the multidomain architectures.
pfam17451	Glyco_hyd_101C	5.43e-26	895	992	3	111	Glycosyl hydrolase 101 beta sandwich domain. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae is largely determined by the ability to degrade host glycoproteins and to metabolize the resultant carbohydrates. This family is the enzymatic region, EC:3.2.1.97, of the cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins. This reaction is exemplified by a S. pneumoniae protein, where Asp764 is the catalytic nucleophile-base and Glu796 the catalytic proton donor. This domain represents C-terminal the beta sandwich domain.
pfam17974	GalBD_like	6.32e-12	1187	1265	17	114	Galactose-binding domain-like. Proteins containing a galactose-binding domain-like fold can be found in several different protein families, in both eukaryotes and prokaryotes. The common function of these domains is to bind to specific ligands, such as cell-surface-attached carbohydrate substrates for galactose oxidase and sialidase, phospholipids on the outer side of the mammalian cell membrane for coagulation factor Va, membrane-anchored ephrin for the Eph family of receptor tyrosine kinases, and a complex of broken single-stranded DNA and DNA polymerase beta for XRCC1. The structure of the galactose-binding domain-like members consists of a beta-sandwich, in which the strands making up the sheets exhibit a jellyroll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATD58436.1	0.0	1	1552	286	1839
ATD54117.1	0.0	1	1552	286	1839
QBJ76357.1	0.0	1	1552	286	1839
SLK22612.1	0.0	1	1552	286	1839
BBK22105.1	0.0	1	1547	100	1677

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6QEP_A	2.42e-109	399	1318	7	1079	EngBFDARPin Fusion 4b H14 [Bifidobacterium longum]
2ZXQ_A	3.19e-109	399	1318	22	1094	Crystalstructure of endo-alpha-N-acetylgalactosaminidase from Bifidobacterium longum (EngBF) [Bifidobacterium longum]
6QEV_B	8.48e-109	404	1318	12	1079	EngBFDARPin Fusion 4b B6 [Bifidobacterium longum]
6SH9_B	8.48e-109	404	1318	12	1079	EngBFDARPin Fusion 4b D12 [Bifidobacterium longum subsp. longum JCM 1217]
6QFK_A	8.48e-109	404	1318	12	1079	EngBFDARPin Fusion 4b G10 [Bifidobacterium longum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A9WNA0	1.63e-105	404	1306	52	1004	Putative endo-alpha-N-acetylgalactosaminidase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) OX=288705 GN=RSal33209_1326 PE=3 SV=2
Q2MGH6	5.30e-103	399	1416	329	1494	Endo-alpha-N-acetylgalactosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0368 PE=1 SV=1
Q8DR60	2.26e-102	399	1416	329	1494	Endo-alpha-N-acetylgalactosaminidase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=spr0328 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000010	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001423_00483.