CAZyme Information: MGYG000001423_00621

Basic Information

• Species: Clostridium celatum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium celatum
• CAZyme ID: MGYG000001423_00621
• CAZy Family: GH123
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1652	MGYG000001423_18|CGC2	183195.24	4.2063

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001423	3553421	Isolate	not provided	not provided

• Gene Location: Start: 62784; End: 67742 Strand: -

Full Sequence      

MPDVLYTEGPVNVEFNALQPIWVEINVPENATSGVYEGTVTVTADGVDDIVFNYALEVLD
VTMPSSSEYEFDFEAWQYPYSSAEYYGVEPFSEEHLAILTPHMLKYKELGGHAITASIVE
EAWGGQTYSENEIRYPSMIKWTRNADGTFSFDYTDFDKWVQFNKDLGIGDKIVCYSMIPW
GNNVKYYDEASGTTMVENLPAGTTRYEEVWLQFLNKLVIHLDEKGWFDDTYIGIDERSNM
DKAFDVIDKVKNRHDKVLKKAAAMDHFSTSYKYITDRVDDLSVGSTAAKGSLADYKNFVA
ERAEAEKEYKTTIYTCTEHFPNSLALSMPGESYWTMMFTAAQGATGYMRWAFDAWVQDPL
RDTTHWAFEAGDTFLIYPDEKDSENITSKTSVRLEKMAEGIRDVNKLYMMQNEVPSLKAD
IDNLLATVKLNYTGTKNGVGDHGGAKYATDETRAMIPDDMAAIKAEIKNITEKYIELRDG
GVNTIDSVEINNGNQEMNLGEKLSLNVTVMPENALNKEVIWTSSNTSVATVNSQGVVTGV
KVGTVQITATSAQDSSKKSTINLVVNKKAIEEEAKVAYYSFDNIDGNVVENVWADGSLYN
GTINGPVVVEGKSGNALNFIAGTNNVEIESPANLPENWTIAFWVNRGNEEGTASVMWDGR
TATGSSELNSVSVDLAVGVGANASKPGVHVNQGTLSFPTEIAKNQWLHVAYTNSVAEGLA
LYVNGEKIGTTNAYTKNNPMKAPLEFIGGRGFVGQLDELKVYNRALTAEEIIEAKAVNGL
NVDTNYKEIYINESVQIIAELISDKAEDNIIFTSDNENIATVSENGLVTGVAYGDTFITV
SNESGEYSETVDIRVNRRINYQNTLETYEIPAEEQIVIDREDGQYLGQPDTILLDDDKTL
LTVYPKGHGFGEALLSKSTDGGLTWEKRVPVNETWVNSEETPTIYKLDFVDGSQKLISIS
GGPEWHGSTFRGFKTSISDDNGETWGDYTEWNTGIRTIVAMASLIQLKDENGNYIDKWMG
VFHDYGYVNYKTYLTFDENGQEQWSDPEPYLSEYRTLESTYQICEVGMFRSPDGNRIVAL
ARSQSHKHTSTIFYSDDEGETWSRPREVQGSLNGERHKAVYDPISGRLLISFREIKLDTN
LDGNTSDGDWMAGDWIGWVGTYEDLMNGNDGEYRIRLAKDYTNSAKAGDTGYAGNVVMSD
GTFFLNSYGNFDTNTNNNTYIIGLRFKLGEIDNALGKVNRESLKVLLQEVEGLNGELYTE
ESYSVLMNVYNEAREIYEDNSSAQAQIDSIVVELNAAKENLKEADVTPEPEVNKELLKST
IDYAQSVKEQGALEGLVPVVVKEFNSSLEQAQEIYANVKATEAEVEAACNRLLQAIWMLE
FEVGDKDALKAIIDIAEALVEGDYTSESWSKLQSALVSAGKVYEDENALVEEVNKAIADL
QEAIDGLVKNNVNKDALQNLINMINGLSDKEDQYIELTWANLKAELTGALVVLENENSTQ
EDVDSAYNKLMRAYLQLRLKPSKDLLEDLLNKVNELDSSKYTVATWRSVEEAVERASKIL
EDSSATEKEIVEAEEELRVAISNLKEVSVSDNSSNSNNRSNNSASGNTNNGGASTNSGKL
PQTGGTSALMVVLVGAIIAGAGFFMFKKKKTN

Enzyme Prediction     

No EC number prediction in MGYG000001423_00621.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH123	1	429	1.5e-145	0.7546468401486989

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13320	DUF4091	4.32e-19	343	409	1	64	Domain of unknown function (DUF4091). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, archaea and eukaryotes, and is approximately 70 amino acids in length. There is a single completely conserved residue G that may be functionally important.
pfam13385	Laminin_G_3	8.69e-18	622	771	3	150	Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.
cd15482	Sialidase_non-viral	2.68e-08	914	1108	48	243	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
COG5492	YjdB	2.71e-07	433	626	129	324	Uncharacterized conserved protein YjdB, contains Ig-like domain [General function prediction only].
TIGR01167	LPXTG_anchor	2.25e-06	1619	1652	1	34	LPXTG-motif cell wall anchor domain. This model describes the LPXTG motif-containing region found at the C-terminus of many surface proteins of Streptococcus and Streptomyces species. Cleavage between the Thr and Gly by sortase or a related enzyme leads to covalent anchoring at the new C-terminal Thr to the cell wall. Hits that do not lie at the C-terminus or are not found in Gram-positive bacteria are probably false-positive. A common feature of this proteins containing this domain appears to be a high proportion of charged and zwitterionic residues immediatedly upstream of the LPXTG motif. This model differs from other descriptions of the LPXTG region by including a portion of that upstream charged region. [Cell envelope, Other]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYE35220.1	0.0	1	1310	380	1689
QAS60616.1	0.0	1	1310	380	1689
BBA47625.1	0.0	3	1361	364	1713
ADP36622.1	0.0	3	1361	364	1713
VEG17315.1	0.0	3	1361	385	1734

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FQE_A	3.28e-109	2	477	128	605	Thedetails of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQE_B The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQF_A The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQF_B The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FR0_A The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens]
5FQG_A	4.08e-108	2	477	128	605	Thedetails of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQH_A The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens]
5L7V_A	4.71e-84	16	430	146	538	ChainA, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7V_B Chain B, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482]
5L7R_A	6.96e-84	16	430	161	553	ChainA, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7R_B Chain B, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7U_A Chain A, Glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7U_B Chain B, Glycoside hydrolase [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH9	1.27e-11	1385	1577	1667	1868	Beta-L-arabinobiosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA2 PE=1 SV=1
P35838	4.61e-06	374	574	114	325	Uncharacterized protein CA_C0552 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=CA_C0552 PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
1624	1646