CAZyme Information: MGYG000001423_02310

Basic Information

• Species: Clostridium celatum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium celatum
• CAZyme ID: MGYG000001423_02310
• CAZy Family: GH84
• CAZyme Description: O-GlcNAcase NagJ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
627		71268.3	4.1353

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001423	3553421	Isolate	not provided	not provided

• Gene Location: Start: 20215; End: 22098 Strand: -

Full Sequence      

MAREKFAKKVGVSLAIMLAINSMASISVQATTEITNEVVNTLSEKKLTINPLPQSMEILN
GQVELTETINIIGADQADLYAVELLKSILTNMDITVNEIPVEGATTIYIGEVNDNIVEME
DAITELAVDTSTVTKSEGYILAAKDDEAGDKIIIRGNDESGTFYGVQTLKQIIENDNDKN
IEEVVIKDEPNIELRAVVEGFYGTPWTQEERLDQLKMYGENKMNAYIYAPKSDPYHRDLW
REPYPESELDRMQELIYTANENKVDFIFAISPGIDIKFDGEEGEADFQALLNKCETLYEM
GVRRFAILWDDIEHSQGDKHAEILNRFNEEFVKVKDGVKSLITVPKEYWETSMFDLDGVT
IQKYTKDFAETLDEDIEVMWTGHHVIPSHGVTMEDVDVVTNIYGKKMMLWWNYPVNDYKE
DKLGLGPMYGFDNNLDEKMSGFIINPMRFAEASKISTLTGADYAWNTKAYDYERSWDNAL
KVVGGEAKEELKYVADHSTRLDTGRPDSPELDSFIETMWEKWDNGEDVSSELATLKSEFE
KMISTPDSLREKLDNEELLSQMEKQLVKFEKYGEVGLGIVSMLESIQNDDMVGFWNKKYE
GMKALAELDSLEGIIAEKVVDPFIRIS

Enzyme Prediction     

No EC number prediction in MGYG000001423_02310.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	195	495	9.9e-107	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	4.76e-143	195	492	1	291	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	3.94e-20	46	188	1	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYE33861.1	3.80e-294	1	625	1	623
QAS62004.1	3.80e-294	1	625	1	623
AYE33864.1	3.44e-284	1	625	1	621
QAS62007.1	3.44e-284	1	625	1	621
AMN32340.1	2.17e-275	1	625	1	624

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PV5_A	1.04e-280	36	625	29	617	Structureof CpGH84B [Clostridium perfringens ATCC 13124]
2CBI_A	4.79e-174	49	625	16	584	Structureof the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue of human O-GlcNAcase [Clostridium perfringens],2CBI_B Structure of the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue of human O-GlcNAcase [Clostridium perfringens],2CBJ_A Structure of the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue of human O-GlcNAcase in complex with PUGNAc [Clostridium perfringens],2CBJ_B Structure of the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue of human O-GlcNAcase in complex with PUGNAc [Clostridium perfringens],2V5C_A Family 84 glycoside hydrolase from Clostridium perfringens, 2.1 Angstrom structure [Clostridium perfringens],2V5C_B Family 84 glycoside hydrolase from Clostridium perfringens, 2.1 Angstrom structure [Clostridium perfringens],2VUR_A Chemical dissection of the link between Streptozotocin, O-GlcNAc and pancreatic cell death [Clostridium perfringens],2VUR_B Chemical dissection of the link between Streptozotocin, O-GlcNAc and pancreatic cell death [Clostridium perfringens],2X0Y_A Screening-based discovery of drug-like O-GlcNAcase inhibitor scaffolds [Clostridium perfringens],2X0Y_B Screening-based discovery of drug-like O-GlcNAcase inhibitor scaffolds [Clostridium perfringens]
5OXD_A	5.94e-174	49	625	18	586	Complexof a C. perfringens O-GlcNAcase with a fragment hit [Clostridium perfringens]
2J62_A	6.78e-174	49	625	16	584	Structureof a bacterial O-glcnacase in complex with glcnacstatin [Clostridium perfringens],2J62_B Structure of a bacterial O-glcnacase in complex with glcnacstatin [Clostridium perfringens],2WB5_A GlcNAcstatins are nanomolar inhibitors of human O-GlcNAcase inducing cellular hyper-O-GlcNAcylation [Clostridium perfringens],2WB5_B GlcNAcstatins are nanomolar inhibitors of human O-GlcNAcase inducing cellular hyper-O-GlcNAcylation [Clostridium perfringens]
4ZXL_A	2.35e-173	49	625	8	576	CpOGAD298N in complex with Drosophila HCF -derived Thr-O-GlcNAc peptide [Clostridium perfringens ATCC 13124]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0TR53	4.51e-168	49	625	46	614	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	1.78e-167	49	625	46	614	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q89ZI2	1.13e-106	45	607	22	557	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
P26831	9.12e-50	42	604	34	615	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
O60502	5.05e-40	194	463	61	331	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000291	0.998981	0.000204	0.000174	0.000159	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001423_02310.