CAZyme Information: MGYG000001423_02653

Basic Information

• Species: Clostridium celatum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium celatum
• CAZyme ID: MGYG000001423_02653
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
259		28792.65	4.4276

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001423	3553421	Isolate	not provided	not provided

• Gene Location: Start: 2575; End: 3354 Strand: -

Full Sequence      

MRGMHNRKAFKKVLPLFLASSMVLSNISVFATENTNGESNLALNKTTFSSGDETEGFNST
KVTDGIINRNANNGEQSRWASVRYAENPYVGVDLGEKTVFNEVVIEWERKNINSYEIQIS
DDKDSWTTIYTGTTVNNYRDVISLGNQEARYVRAVVKEYDPAEEGSTISWETVSVYELEV
YNRDSVVRPEAGVNIALNKTATASSQEGGTSFSAAKAFDGTIDRTSTKQSRWASAVSSED
QWLKVDLGEVTEFDNIVIE

Enzyme Prediction     

No EC number prediction in MGYG000001423_02653.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM32	46	178	1.2e-18	0.9354838709677419

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00754	F5_F8_type_C	1.83e-10	49	161	4	117	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam00754	F5_F8_type_C	1.40e-06	200	258	1	52	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	6.47e-05	70	181	32	142	Substituted updates: Jan 31, 2002

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYE33718.1	6.83e-91	1	259	1	257
QAS61873.1	6.83e-91	1	259	1	257
ATD55826.1	8.11e-90	1	259	1	257
SLK21750.1	8.11e-90	1	259	1	257
QBJ76126.1	8.11e-90	1	259	1	257

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RVA_A	1.70e-12	40	153	7	116	Solutionstructure of chitosan-binding module 2 derived from chitosanase/glucanase from Paenibacillus sp. IK-5 [Paenibacillus fukuinensis]
4ZZ5_A	1.74e-12	40	153	8	117	X-raycrystal structure of chitosan-binding module 2 derived from chitosanase/glucanase from Paenibacillus sp. IK-5 [Paenibacillus fukuinensis],4ZZ5_B X-ray crystal structure of chitosan-binding module 2 derived from chitosanase/glucanase from Paenibacillus sp. IK-5 [Paenibacillus fukuinensis],4ZZ8_A X-ray crystal structure of chitosan-binding module 2 in complex with chitotriose derived from chitosanase/glucanase from Paenibacillus sp. IK-5 [Paenibacillus fukuinensis],4ZZ8_B X-ray crystal structure of chitosan-binding module 2 in complex with chitotriose derived from chitosanase/glucanase from Paenibacillus sp. IK-5 [Paenibacillus fukuinensis]
2RV9_A	2.06e-06	194	248	7	54	Solutionstructure of chitosan-binding module 1 derived from chitosanase/glucanase from Paenibacillus sp. IK-5 [Paenibacillus fukuinensis]
4ZXE_A	2.09e-06	194	248	8	55	X-raycrystal structure of chitosan-binding module 1 derived from chitosanase/glucanase from Paenibacillus sp. IK-5. [Paenibacillus fukuinensis],4ZXE_B X-ray crystal structure of chitosan-binding module 1 derived from chitosanase/glucanase from Paenibacillus sp. IK-5. [Paenibacillus fukuinensis],4ZXE_C X-ray crystal structure of chitosan-binding module 1 derived from chitosanase/glucanase from Paenibacillus sp. IK-5. [Paenibacillus fukuinensis]
4ZY9_A	2.09e-06	194	248	8	55	X-raycrystal structure of selenomethionine-labelled V110M mutant of chitosan-binding module 1 derived from chitosanase/glucanase from Paenibacillus sp. IK-5 [Paenibacillus fukuinensis],4ZY9_B X-ray crystal structure of selenomethionine-labelled V110M mutant of chitosan-binding module 1 derived from chitosanase/glucanase from Paenibacillus sp. IK-5 [Paenibacillus fukuinensis]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000332	0.998974	0.000194	0.000169	0.000157	0.000139

TMHMM  Annotations     

start	end
13	32