CAZyme Information: MGYG000001425_01397

Basic Information

• Species: Peptoniphilus_A senegalensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; Peptoniphilus_A; Peptoniphilus_A senegalensis
• CAZyme ID: MGYG000001425_01397
• CAZy Family: GH73
• CAZyme Description: Exo-glucosaminidase LytG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
189		21948.1	9.3796

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001425	1816368	Isolate	not provided	not provided

• Gene Location: Start: 580096; End: 580665 Strand: +

Full Sequence      

MKIRKIGCGCLVILITFFGIIFMMSFFINRASEKRALEEENYRENYIEDSADLAVKIAKK
NKLYPSVMIAQSILESNWGRSELSRDYNNYFGIKEVKKGEGIVFETEEYVEGKSGRYLEN
FKKYSSKRESFNHYAKLLSTAKRYEKVKTAKNYSEAAKFIQEGGYATDPNYANKIISVIE
KYGLNKYDE

Enzyme Prediction     

No EC number prediction in MGYG000001425_01397.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	51	184	1.1e-37	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	2.08e-55	44	189	44	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
TIGR02541	flagell_FlgJ	5.13e-34	54	181	159	292	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.
PRK08581	PRK08581	5.74e-32	44	188	321	472	amidase domain-containing protein.
PRK05684	flgJ	4.35e-31	65	181	174	296	flagellar assembly peptidoglycan hydrolase FlgJ.
smart00047	LYZ2	6.58e-30	44	188	9	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEJ35583.1	1.87e-98	1	189	1	189
QQE46577.1	1.87e-98	1	189	1	189
QQT90265.1	5.36e-98	1	189	1	189
CDZ75698.1	1.04e-46	41	189	39	185
CBH20308.1	1.33e-37	33	188	48	204

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	4.06e-26	42	188	29	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN5_A	3.28e-18	53	181	12	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	4.58e-18	53	181	12	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5T1Q_A	5.62e-17	46	189	63	213	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3VWO_A	7.05e-17	54	186	12	150	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	4.62e-31	38	189	43	199	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9CIT4	6.62e-24	41	188	60	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
A2RHZ5	6.14e-23	41	188	60	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	1.60e-22	41	188	60	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
P39046	1.28e-21	46	188	65	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.948185	0.007964	0.036581	0.000061	0.000041	0.007190

TMHMM  Annotations     

start	end
7	29