CAZyme Information: MGYG000001426_01191

Basic Information

• Species: Phytobacter massiliensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Phytobacter; Phytobacter massiliensis
• CAZyme ID: MGYG000001426_01191
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
208	MGYG000001426_1|CGC20	22890.02	9.9437

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001426	4922332	Isolate	not provided	not provided

• Gene Location: Start: 1264839; End: 1265465 Strand: -

Full Sequence      

MNLTKFQQAAGLSAGLAARWFPHIDAAMKEFGITAPVDQAMFIAQTGHESVGFTRLVESM
NYSVAGLAGFVRAGRLTQDQANMLGRRSYEKALTLERQRAIANLVYSKRLGNNASGDGWK
YRGRGLIQITGLANYRDCGSALKLDLVTSPELLEQDRNAARSAAWFYVTSGCLLYSGDLE
RITQIINGGHNGIEDRRLRYNRAQAALL

Enzyme Prediction     

EC	3.2.1.17

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	17	188	1.4e-34	0.5627705627705628

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3179	COG3179	2.14e-71	1	208	4	205	Predicted chitinase [General function prediction only].
cd00325	chitinase_GH19	1.49e-09	22	208	25	214	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
pfam00182	Glyco_hydro_19	2.19e-08	40	169	54	156	Chitinase class I.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VDZ73109.1	8.24e-129	1	208	1	208
QPS90080.1	8.24e-129	1	208	1	208
QFH71197.1	9.61e-128	1	208	1	208
QFH70942.1	6.48e-126	1	208	1	208
QFH70975.1	1.07e-124	1	208	1	208

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OK7_A	2.41e-105	1	207	16	222	ChainA, Endolysin [Salmonella phage SPN1S],4OK7_B Chain B, Endolysin [Salmonella phage SPN1S],4OK7_C Chain C, Endolysin [Salmonella phage SPN1S]
4MST_A	8.43e-07	118	169	105	157	CrystalStructure of a putative catalytic domain of a chitinase-like protein (HbCLP1) from Hevea brasiliensis [Hevea brasiliensis],4MST_B Crystal Structure of a putative catalytic domain of a chitinase-like protein (HbCLP1) from Hevea brasiliensis [Hevea brasiliensis]
3WH1_A	1.64e-06	118	189	91	167	CrystalStructure of a Family GH19 Chitinase from Bryum coronatum in complex with (GlcNAc)4 at 1.0 A resolution [Gemmabryum coronatum]
4IJ4_A	2.22e-06	118	189	90	166	CrystalStructure of a Family GH19 chitinase from Bryum coronatum in complex with (GlcNAc)4 [Gemmabryum coronatum]
7F88_A	2.82e-06	120	189	84	158	ChainA, Chitinase A [Gemmabryum coronatum],7F88_B Chain B, Chitinase A [Gemmabryum coronatum],7F88_C Chain C, Chitinase A [Gemmabryum coronatum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44187	2.71e-26	21	196	14	187	Glycosyl hydrolase family 19 domain-containing protein HI_1415 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1415 PE=3 SV=1
O64203	4.13e-09	8	205	187	359	Endolysin A OS=Mycobacterium phage D29 OX=28369 GN=10 PE=1 SV=1
Q7XCK6	5.08e-06	121	170	128	178	Chitinase 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Cht8 PE=2 SV=1
Q8GUD7	5.74e-06	118	169	158	210	Probable inactive chitinase-like protein LaCIC (Fragment) OS=Hevea brasiliensis OX=3981 GN=LACIC PE=1 SV=1
Q949H3	6.03e-06	118	169	177	229	Inactive chitinase-like protein 1 OS=Hevea brasiliensis OX=3981 GN=CHI-L1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998990	0.000997	0.000035	0.000003	0.000001	0.000004

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001426_01191.