CAZyme Information: MGYG000001426_02007

Basic Information

• Species: Phytobacter massiliensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Phytobacter; Phytobacter massiliensis
• CAZyme ID: MGYG000001426_02007
• CAZy Family: GH140
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
444	MGYG000001426_1|CGC28	50808.41	6.1871

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001426	4922332	Isolate	not provided	not provided

• Gene Location: Start: 2094703; End: 2096037 Strand: -

Full Sequence      

MKKLYVNGRSFYNEAHQPFFYTACTAWELFHKLTLEEAGRYLINRAEKGFNVIQAVAVCE
LDGLHTPSVEGGHLPFLDLHNLEPNNAWFDHVRKVTQMANQLGIYIALVPMWGSHWSVNN
SWGADKKPLFNKGNISAFCRYLSDKMAGTGIIWMTGGDRGISTPEQREIVKEMVMGLRAG
GSGDALLTVHSQGGRSTLDMLDGALQQDFIVWQTGHMGQAYPSWRPVEMDYLRQDKPVLD
SEPCYEAHPVMCQHQFRRAQDASRFTDREIRRSSYWSVFAGGAGITYGCYSLWQMRRPED
DAQAIPESAASTYQGDTIPYWFDALNYPGAFNIGTLRRFIESLPEWWLREPDQTLLLNAN
PVDERHCRAIRDAQRRWIAVYIPEQQNVVVDVRDFAQTGFDIGWFDPRYGVMNWVSHDIS
ETFFLSIDPPQTGTDWVLVLRKKS

Enzyme Prediction     

No EC number prediction in MGYG000001426_02007.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	7	438	2.8e-97	0.9805825242718447

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13204	DUF4038	7.96e-98	7	343	1	320	Protein of unknown function (DUF4038). A family of putative cellulases.
pfam12904	Collagen_bind_2	1.25e-12	351	440	2	91	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUV02051.1	1.23e-310	1	444	1	444
AVG76174.1	9.32e-269	1	444	1	443
ADD76253.1	3.79e-268	1	444	1	443
ASN16069.1	1.54e-267	1	444	1	443
QKV87450.1	1.54e-267	1	444	1	443

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	1.56e-33	8	444	24	448	Glycosidehydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	4.55e-31	8	444	24	448	Crystalstructure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4QFU_A	1.08e-30	8	440	37	460	ChainA, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_B Chain B, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_C Chain C, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_D Chain D, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_E Chain E, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_F Chain F, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_G Chain G, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_H Chain H, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_I Chain I, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_J Chain J, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_K Chain K, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_L Chain L, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001426_02007.