CAZyme Information: MGYG000001426_03134

Basic Information

• Species: Phytobacter massiliensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Phytobacter; Phytobacter massiliensis
• CAZyme ID: MGYG000001426_03134
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
604		69523.2	6.2968

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001426	4922332	Isolate	not provided	not provided

• Gene Location: Start: 363359; End: 365173 Strand: -

Full Sequence      

MGFYFSRFEDRQPPEPLKTPRWVMIAWQILAVAALILGANYIYWRWTASLNTDALWYAIP
LVLAETLAWIGTVLFTINLWKEEDPPQNPPPADINDCLEAQEAVEPRPLKVDLFIATYSE
DVELVRLSIRDAVKMAYPFPLDYRVHVLDDGRRPEMKAVCEEEGVNYITRQNNIGYKAGN
LRNGLEQTDGDFIVICDADTRVFPTLLSHTLGYFRDPDVAWVQTPQWFYDLPEGENLARW
LKRKMGGAGFALGWLAQKVVGPVTVGRDPFFNDPRMFYDVILRRRNWANAAFCCGAASVH
RREAVMQAALRSYVWTVEEEIDRHTRDIRDPVTREALQDAMRPHVVYDTELTPYKFHVSE
DIYTSILLHGDAARRWRSVMHPRIESKMLSPQDMLTWMIQRFKYAAGSLDILFHDNIFSR
RRFKLSLPQTLMYATTFWSYMACVWNTVFLISPIVYLFTGIPPVSAWSTPFYLHFLPFFI
FSELAFMFGTWGISAWDGRASYLSFFSMNLRALNTVLRGEQIKFHVTPKERQAGRFLYLV
KPQIAIVLLTLTGLIWGGIQVARGQVDDPSGYVINIFWGAVNIAAMLPLILAAMWTPADE
EASE

Enzyme Prediction     

No EC number prediction in MGYG000001426_03134.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	113	305	2e-21	0.9647058823529412

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06421	CESA_CelA_like	1.66e-77	110	412	2	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
PRK11498	bcsA	1.67e-35	29	457	188	535	cellulose synthase catalytic subunit; Provisional
COG1215	BcsA	1.17e-23	44	513	3	400	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	1.73e-17	113	308	1	169	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06437	CESA_CaSu_A2	3.12e-16	123	224	14	122	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AST70754.1	0.0	1	602	1	602
AZI86242.1	0.0	1	602	1	602
APZ04626.1	0.0	1	602	1	602
BCU54285.1	0.0	1	601	1	601
QAR44942.1	0.0	1	602	1	602

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	5.91e-29	12	586	169	682	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	1.80e-25	29	555	56	524	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	2.04e-25	29	555	68	536	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	2.04e-25	29	555	69	537	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0CW87	6.48e-31	111	590	151	564	Cellulose synthase 1 OS=Komagataeibacter xylinus OX=28448 GN=acsAB PE=1 SV=1
Q76KJ8	6.48e-31	111	590	151	564	Cellulose synthase 1 OS=Komagataeibacter hansenii OX=436 GN=acsAB PE=1 SV=1
P58931	1.91e-30	30	583	88	565	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2
P37653	3.18e-28	12	586	169	682	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3
Q8X5L7	7.50e-28	12	586	169	682	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	42
55	77
436	458
471	493
536	558
571	593