CAZyme Information: MGYG000001426_04100

Basic Information

• Species: Phytobacter massiliensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Phytobacter; Phytobacter massiliensis
• CAZyme ID: MGYG000001426_04100
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
267	MGYG000001426_5|CGC4	29747.17	5.2754

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001426	4922332	Isolate	not provided	not provided

• Gene Location: Start: 135553; End: 136356 Strand: +

Full Sequence      

MLFTAPDGVWLFYKVGSGVHVWQTRYVKSTDGGRSWSAPAELVAGDPLPRGPVKNKILHT
SDGVWLAPGSTEDERHWDAFVDRSCDGGQSWQLSPVPLAHQTFSGQSSQLWQGLKDEALW
ENDLSRVLRWDGVIQPSLWESAPGQIHMLMRSTRGWLYRSDSTDNGRSWCPAYATTLPNN
NSGIDLVQTASGTLVLACNPTGGNWGQRFPLTLLVSEDNGVSWTHALDVETGEGEFSYPA
IIRDGERLHLTWTWNRTNIMHCELQLA

Enzyme Prediction     

No EC number prediction in MGYG000001426_04100.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	9	252	1e-18	0.6754385964912281

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4692	COG4692	2.58e-73	2	267	92	374	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam13088	BNR_2	5.55e-68	1	250	55	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	5.24e-30	9	258	90	328	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
COG4409	NanH	1.15e-04	86	241	552	687	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKL13497.1	1.47e-156	1	267	80	347
AUV02432.1	1.99e-154	1	267	80	347
QKJ58436.2	3.21e-139	9	267	88	347
AHG21530.1	3.21e-139	1	267	80	347
QBH94981.1	1.37e-123	9	261	89	342

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000012	0.000034	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001426_04100.