CAZyme Information: MGYG000001426_04107

Basic Information

• Species: Phytobacter massiliensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Phytobacter; Phytobacter massiliensis
• CAZyme ID: MGYG000001426_04107
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
279		32196.79	5.0901

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001426	4922332	Isolate	not provided	not provided

• Gene Location: Start: 146453; End: 147292 Strand: -

Full Sequence      

MSQPAFAWVTLLTQPGYVPGVEALRRSLRQSGSPWPLVVMVTANIDAATREKLTAQACLV
KEVPVLGPDPALAHRYANARFADVWSKLAVWTLTDYTRVAFLDADMLVVQNMDELFELPL
QEGFIAACHACRCNPNRIATYPASWQPENCYYSWCEDAQMTAHPPATVDNYLNGGFLLLT
PDQQVYDQMLAQLLALTDISAYVFAEQDFLNEFFRDRWLPLHYGYNALKTLALQHPQMWD
QARVKNIHYIIDKPWEKFPQPGDKWYELHRLWWEYQPQP

Enzyme Prediction     

No EC number prediction in MGYG000001426_04107.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	8	257	2.5e-48	0.8715953307392996

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02537	GT8_Glycogenin	4.27e-75	6	275	1	236	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
PLN00176	PLN00176	3.11e-39	7	255	24	266	galactinol synthase
cd04194	GT8_A4GalT_like	4.74e-17	93	257	93	248	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
pfam01501	Glyco_transf_8	7.44e-16	17	255	10	248	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
COG1442	RfaJ	6.10e-12	93	269	95	258	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJF19182.1	1.00e-182	5	277	4	276
AUU89560.1	1.42e-182	5	277	4	276
AUV10391.1	1.42e-182	5	277	4	276
BBE79443.1	4.07e-182	5	277	4	276
QIH64974.1	4.07e-182	5	277	4	276

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MW5_A	6.79e-21	7	274	9	254	UDP-galactose:glucoside-Skp1alpha-D-galactosyltransferase with bound UDP and Platinum [Globisporangium ultimum],6MW8_A UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Manganese [Globisporangium ultimum]
3USQ_A	3.68e-11	7	255	25	240	Structureof D159S/Y194F glycogenin mutant truncated at residue 270 [Oryctolagus cuniculus]
3RMV_A	3.97e-11	7	264	6	230	CrystalStructure of Human Glycogenin-1 (GYG1) T83M mutant complexed with manganese and UDP [Homo sapiens],3RMW_A Crystal Structure of Human Glycogenin-1 (GYG1) T83M mutant complexed with manganese and UDP-glucose [Homo sapiens]
3Q4S_A	3.97e-11	7	264	6	230	CrystalStructure of Human Glycogenin-1 (GYG1), apo form [Homo sapiens],3QVB_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and UDP [Homo sapiens],3U2W_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and glucose or a glucal species [Homo sapiens],3U2W_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and glucose or a glucal species [Homo sapiens]
3V90_A	4.99e-11	7	255	25	240	Structureof T82M glycogenin mutant truncated at residue 270 [Oryctolagus cuniculus],3V91_A Structure of T82M glycogenin mutant truncated at residue 270 complexed with UDP-glucose [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4PSY4	9.73e-35	7	255	21	264	Galactinol synthase 7 OS=Arabidopsis thaliana OX=3702 GN=GOLS7 PE=2 SV=1
Q9XGN4	1.94e-34	8	274	25	289	Galactinol synthase 1 OS=Ajuga reptans OX=38596 GN=GOLS1 PE=1 SV=1
Q947G8	2.79e-34	1	256	15	254	Galactinol synthase 1 OS=Solanum lycopersicum OX=4081 GN=GOLS1 PE=2 SV=1
O22693	7.57e-34	2	269	19	292	Galactinol synthase 4 OS=Arabidopsis thaliana OX=3702 GN=GOLS4 PE=2 SV=1
O80518	1.48e-33	7	274	17	283	Galactinol synthase 3 OS=Arabidopsis thaliana OX=3702 GN=GOLS3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001426_04107.