CAZyme Information: MGYG000001428_00531

Basic Information

• Species: Bacillus_BN massilioanorexius
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; DSM-1321; Bacillus_BN; Bacillus_BN massilioanorexius
• CAZyme ID: MGYG000001428_00531
• CAZy Family: GH170
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362	MGYG000001428_36|CGC2	41222.95	6.2907

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001428	4588934	Isolate	not provided	Europe

• Gene Location: Start: 51845; End: 52933 Strand: -

Full Sequence      

MRKLGISIYPEHSTREKDKEYISLAAKYGFKRIFTCLLSVQGSKEAIIEEFTDIITHARN
EGMEVILDVAPHVFPTLGASYDNLEVFAQMGATGIRLDEGFGGQKEALMTHNPYGLKIEI
NISNGTKYLEQILSYGPNRDTLVGCHNFYPQEYTGLSYKHFVETSELFRKHNIRVAAFVS
SKAATYGPWPVSDGLCTLEQHRTLPIVTQAKHLFATDLVDDVIIGNAYASEEELAALSKL
NPNKLSFRVNMNKEASDLEKLIVEKEIHFNRGDVSEYLIRSTQSRVKYKTEAFPKHNNYD
IQKGDVLMGNNDFGQYKGELQIARLPMKNDGRKNVIGRIVEEEVFLLDYIKPWDYFEMVI
EK

Enzyme Prediction     

No EC number prediction in MGYG000001428_00531.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH170	3	358	7e-127	0.9942857142857143

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3589	COG3589	6.87e-140	1	362	1	360	Uncharacterized protein [Function unknown].
pfam19200	DUF871_N	1.79e-130	4	239	1	235	DUF871 N-terminal domain. This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.
pfam05913	DUF871	1.05e-49	245	359	1	116	Bacterial protein of unknown function (DUF871). This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.
cd07589	BAR_DNMBP	0.004	17	89	3	72	The Bin/Amphiphysin/Rvs (BAR) domain of Dynamin Binding Protein. BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. DyNamin Binding Protein (DNMBP), also called Tuba, is a Cdc42-specific Guanine nucleotide Exchange Factor (GEF) that binds dynamin and various actin regulatory proteins. It serves as a link between dynamin function, Rho GTPase signaling, and actin dynamics. It plays an important role in regulating cell junction configuration. DNMBP contains BAR and SH3 domains as well as a Dbl Homology domain (DH domain), which harbors GEF activity. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions. The BAR domain of DNMBP may be involved in binding to membranes. The gene encoding DNMBP is a candidate gene for late onset Alzheimer's disease.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWI20580.1	9.48e-172	1	362	1	362
QWH59379.1	3.85e-171	1	362	1	362
ARJ20565.1	3.85e-171	1	362	1	362
QWH05032.1	3.85e-171	1	362	1	362
QWG99430.1	3.85e-171	1	362	1	362

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1X7F_A	3.59e-152	2	359	27	384	Crystalstructure of an uncharacterized B. cereus protein [Bacillus cereus ATCC 14579]
2P0O_A	7.62e-33	5	361	6	360	Crystalstructure of a conserved protein from locus EF_2437 in Enterococcus faecalis with an unknown function [Enterococcus faecalis V583]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0H2XHV5	1.56e-18	5	357	3	342	6-phospho-N-acetylmuramidase OS=Staphylococcus aureus (strain USA300) OX=367830 GN=mupG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001428_00531.