CAZyme Information: MGYG000001428_03098

Basic Information

• Species: Bacillus_BN massilioanorexius
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; DSM-1321; Bacillus_BN; Bacillus_BN massilioanorexius
• CAZyme ID: MGYG000001428_03098
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
295		34104.8	6.6203

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001428	4588934	Isolate	not provided	Europe

• Gene Location: Start: 16223; End: 17110 Strand: +

Full Sequence      

MKKYKIIWPITIILVLIVAWNIFENENKINISIETMKYISTTVDEKSKGKAQVNWKNVAS
VIAAEHDLMDVSTDSIEKTVNLFIEKQDDKYIVKSLDDVTNSLHFSNKQLKTVELYKTYF
DKKGVFTSRMSEDSIHKKFIASIENAAKTNFEKTGILPSITIAQAILESDWGRSKLAVEY
KNLFGIKGHNWNGETASLNTNEFYDKEIKAEFRVYDSITDSINDHGVFLMDNPRYKKHGL
FESKTYLEQAMSLHNANYSTAENEKGEKIYSELLVQLIKQYQLQLIDSQVYEKYN

Enzyme Prediction     

No EC number prediction in MGYG000001428_03098.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	145	283	1.8e-31	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	1.66e-42	138	287	45	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	4.37e-29	139	283	163	308	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
PRK05684	flgJ	1.93e-26	139	280	155	296	flagellar assembly peptidoglycan hydrolase FlgJ.
pfam01832	Glucosaminidase	4.94e-25	152	225	9	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	1.07e-20	136	285	8	143	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOH54741.1	4.35e-97	14	294	9	289
ASV66915.1	8.79e-79	30	292	6	268
QYE98805.1	5.75e-73	10	290	14	293
QEZ67673.1	4.91e-72	2	292	3	295
CEJ72889.1	6.53e-72	10	290	14	293

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DN5_A	3.65e-16	137	280	4	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	5.07e-16	137	280	4	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3FI7_A	7.45e-14	131	287	25	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	2.59e-11	121	289	47	214	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3VWO_A	2.76e-08	152	237	17	110	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	2.48e-20	139	288	51	199	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P15931	1.67e-14	130	280	148	296	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1
P58231	6.51e-13	137	280	150	293	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
P75942	6.51e-13	137	280	150	293	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
Q9CIT4	2.08e-12	139	288	65	215	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.839240	0.080599	0.078334	0.000188	0.000141	0.001521

TMHMM  Annotations     

start	end
7	24