CAZyme Information: MGYG000001429_01558

Basic Information

• Species: Alistipes_A ihumii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes_A; Alistipes_A ihumii
• CAZyme ID: MGYG000001429_01558
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
596	MGYG000001429_54|CGC2	66246.92	6.3285

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001429	2772824	Isolate	not provided	not provided

• Gene Location: Start: 103284; End: 105074 Strand: -

Full Sequence      

MIIRTEMKKLLAFSCLMCAATLSAAGPMGKGSLPPVFPKDVADKAQFDTRTRAYLSPVRV
MWTQNGELIDGAQNLLLQGNGQATTAATPKVVFTAKEGKRPSILLDFGREIHGGLQFVTC
IRASTKPVKVRVRLGESVGEAMCNITPENGATNDHAMRDYTIELPWLGVCEVGNSGFRFV
RIDLLEDDVELPIKEIRASLLYRDIPYLGSFRSSDPRVDSIWMTGAYTLHLNLQEYLVEA
PKRDRLVWLGDLHPEVRTALAVFGDNEALSRGLDFARDETPLPGWMNGMCSYSLWWVLIH
RDYYKYRGDMDYLREQQPYLSQLLRILMSKVDAEGREHLDGGGRFLDWPTSEDTLAIDAG
LHALMLMTLEAGGEMLTALGDKELAGQCFETAGRMKKVTPDYRTSKQSAALIALAGIVPA
EKANEEVLSVGGPHGFSTFYGYYMLQAQAKAGDYAGAIRNMKDYWGGMLDLGATTFWEDF
DVDWLKNAARIDELTPAGKIDVHRTYGDYCYKGYRHSLAHGWASGPTAFLSEYVLGVQIV
EPGCKVVRVEPHLGDLEWVEGTVPTPYGVIRVRHDKRPDGTVRSKIEAPKGVKVIK

Enzyme Prediction     

No EC number prediction in MGYG000001429_01558.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	101	593	1.5e-97	0.9761904761904762

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.65e-19	209	483	4	315	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	6.32e-07	536	593	1	58	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA24783.1	0.0	28	596	1	569
BCI64228.1	0.0	25	596	26	596
BCG54529.1	7.72e-307	32	596	19	583
QUT48045.1	2.81e-264	46	596	20	583
QEC52590.1	4.20e-255	33	596	24	587

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	4.51e-49	78	595	169	694	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	1.42e-17	102	535	94	543	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001280	0.980413	0.017495	0.000295	0.000242	0.000222

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001429_01558.