CAZyme Information: MGYG000001429_01795

Basic Information

• Species: Alistipes_A ihumii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes_A; Alistipes_A ihumii
• CAZyme ID: MGYG000001429_01795
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
630	MGYG000001429_55|CGC3	70656.03	5.1908

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001429	2772824	Isolate	not provided	not provided

• Gene Location: Start: 203659; End: 205551 Strand: +

Full Sequence      

MKKQLLTAAILCCLVIAGSTAAPKSAKKKPKIPVSRVQTHMDGYLGDRIDACIRVRVCSE
DPDLLVAPMRRQTETSLWQSEFWGKWTLGAIASYRYNKDPELLRKIEGGVESLLAAQQPD
GYIGNYAPEAQLTNWDVWGRKYTMLGLLAYYDLTGDKKALDGAVRLADHLLTQIPAVRQI
ERTGIYRGMSSCSILEPIMLLYNRTLDEKYLDFARYIVDRMESADGPQLIAKALDGVPVS
ERFPLDDPSRGWFVWENGQKAYEMMSCYDGLLELYKVTNDPRYLKAVEATVTSIIADEIN
IAGSGSSFECFYKGKALQTEPAYHTMETCVTMTWMKLCYDLLRLTRNPLYADQIERSAYN
ALAASMKEDASQIAKYSPLEGARSAGEEQCGMHVNCCNMNGPRAFALLPEAAVTDYGDEL
FVNLYGPMSSTVRLDGGEVLLEQATSYPEQGDIEIMIDPRKSFEFTVSLRIPAWSAVSMV
TVNGQSVDGATPGEYLRLKRRWEAGDRIGVKLDMRGRLIRRGGFQAIERGPVVLARDTRF
GDGFVDETVVVQATDGFVTLLPVEEKPEKMWMAFTAPMILGTDLEGELAEPRQIMLCDFA
SAGNTWNRNIRYRVWLRRTLNLMKPDGNER

Enzyme Prediction     

No EC number prediction in MGYG000001429_01795.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	72	534	1.2e-58	0.9103053435114504

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	4.56e-69	41	535	5	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.68e-65	43	535	21	501	Uncharacterized conserved protein, DUF1680 family [Function unknown].
PTZ00470	PTZ00470	2.54e-07	146	329	163	351	glycoside hydrolase family 47 protein; Provisional
COG4225	YesR	3.55e-04	135	284	34	157	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
cd04791	LanC_SerThrkinase	6.36e-04	88	215	93	228	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	8.93e-200	41	623	29	613
QHS51661.1	1.50e-50	85	537	123	582
QOY86860.1	7.14e-50	85	568	97	578
AZO44522.1	3.17e-43	20	533	2	560
AXC10260.1	2.26e-42	25	536	83	592

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	2.33e-36	89	540	78	553	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	1.65e-32	85	533	81	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	3.12e-30	85	533	81	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	3.48e-25	79	514	90	579	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000363	0.998822	0.000296	0.000172	0.000162	0.000158

TMHMM  Annotations     

start	end
5	22