CAZyme Information: MGYG000001430_03229

Basic Information

• Species: Holdemania massiliensis
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Holdemania; Holdemania massiliensis
• CAZyme ID: MGYG000001430_03229
• CAZy Family: PL12
• CAZyme Description: Heparin-sulfate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
675	MGYG000001430_5|CGC2	77001.99	5.1766

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001430	3757342	Isolate	not provided	Europe

• Gene Location: Start: 106348; End: 108375 Strand: -

Full Sequence      

MKKNEFFAQNKHFFVEDVEAVKQYVLTHCPQSEIAKIVERADEACAQSFRFDLRWDMEYT
EIPVVFDKEINWLHQPADDPEWIFAFNRHHFWITLGQAYVLTGDEKYAEAFVRQCKSWIC
QINLRDPDCANACRTLETGIRMNLWIKAFCLFRNSPTLTDSFCSLFEESMIEQEKFIAEV
WNSTKIISNWGVLENHGLFTAALLMPEHPFSAAMLQESLHRLDLQLQRQVYPDGVHWEQS
TMYHNEVAQDFLEVKILADRNHIELPEGYNERLAKMIEFCVEHKKPDGIEMAMGDSDDID
VRDIITKAAYSFNNPQWKAAGYTEFDFDCVFDLGAEAAAAYAAMSALPSGRRIVVFPDSG
HIFWHSSDTEDQTWLHFTNGVHGGGHAHEDKLHVDLFYRGEDIVRDSGRLTYVDKPERFE
FKGPKAHNVIELDDQPSILCKRSWGYHKLSWSLNTQASESCGFRLAQGAALGYMDLETGS
AVLSRKVVWLREDLILVHDEIYANPKDTHKIVQRWHFSPAAEVTLKGQTTALSLNHSDCE
VLTLADNAQVRLTDTRLSLHYNTTTPSKMLETELNASGFASITTIFSLNPKGEKAPCFAV
NAPVSLVSRQDRPFAKKVAEGWVIQKGADQFTVMIAHEDYMGPSDAVLVNERQGMGHVIV
WSGMDKEQWGTTLAF

Enzyme Prediction     

No EC number prediction in MGYG000001430_03229.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL12	359	499	2.7e-38	0.9925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16889	Hepar_II_III_N	4.49e-48	67	305	80	326	Heparinase II/III N-terminus. This is the N-terminal domain of heparinase II/III proteins. It is a toroid-like domain.
pfam07940	Hepar_II_III	2.00e-20	348	581	1	230	Heparinase II/III-like protein. This family features sequences that are similar to a region of the Flavobacterium heparinum proteins heparinase II and heparinase III. The former is known to degrade heparin and heparin sulphate, whereas the latter predominantly degrades heparin sulphate. Both are secreted into the periplasmic space upon induction with heparin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS40955.1	3.19e-173	1	661	1	657
ADY12689.1	3.09e-163	1	673	1	664
AEC02932.1	4.27e-155	3	675	2	669
AEN95953.1	4.79e-146	1	661	1	660
SEU00790.1	3.45e-132	1	673	1	670

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MMH_A	5.08e-20	66	441	94	459	Crystalstructure of heparan sulfate lyase HepC from Pedobacter heparinus [Pedobacter heparinus]
4MMI_A	5.08e-20	66	441	94	459	Crystalstructure of heparan sulfate lyase HepC mutant from Pedobacter heparinus [Pedobacter heparinus]
4FNV_A	1.75e-19	2	435	62	517	CrystalStructure of Heparinase III [Bacteroides thetaiotaomicron VPI-5482]
5JMD_A	2.11e-19	66	435	98	473	HeparinaseIII-BT4657 gene product, Methylated Lysines [Bacteroides thetaiotaomicron VPI-5482]
5JMF_A	6.03e-18	66	434	98	472	HeparinaseIII-BT4657 gene product [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59289	2.88e-19	66	441	118	483	Heparin-sulfate lyase OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=hepC PE=1 SV=1
Q89YR9	9.56e-19	2	435	62	517	Heparin-sulfate lyase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=hepC PE=1 SV=1
C7EXL6	7.21e-16	41	435	89	484	Heparin-sulfate lyase OS=Bacteroides stercoris OX=46506 GN=hepC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001430_03229.