CAZyme Information: MGYG000001431_00065

Basic Information

• Species: Helicobacter pylori_BU
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter; Helicobacter pylori_BU
• CAZyme ID: MGYG000001431_00065
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372		42732.42	10.1003

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001431	1602443	Isolate	not provided	not provided

• Gene Location: Start: 1610; End: 2728 Strand: +

Full Sequence      

MEPSRNRLKNTAFFVGLFIVLFLIIMKRQTPPYAFARNQTLVTQNPPYFTQLTIPKPNDA
LSVHASSLISLPNDNLLSAYFSGTKEGARDVKISANLFDSKTNRWSEAFIILTKEELSHH
SHEYIKKLGNPLLFLHDNKILLFVVGVSMGGWATSKIYQFESALEPIHFKFARKLSLSPF
LNLSHLVRNKPLNTTDGGFMLPLYHELATQYPLLLKFDQQNNPRELLRPNTLNHQLQPSL
TPFKDCAVMAFRNHSLKDSLMLETCKTPTAWQKPISTNLKNLDDSLNLLNLNGILYLIHN
PSDSSLRRKELWLSKLENSNSFKTLKVLDKANEVSYPSYSLNPHFIDIVYTYNRSHIKHI
RFNMAYLNSLLK

Enzyme Prediction     

No EC number prediction in MGYG000001431_00065.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4692	COG4692	2.91e-173	1	372	1	381	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam13088	BNR_2	1.38e-73	74	344	1	275	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	7.61e-05	55	156	6	106	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEF24152.1	4.75e-267	1	372	1	372
QEF43228.1	4.75e-267	1	372	1	372
SMA52593.1	1.59e-265	1	372	1	372
AVL49141.1	5.31e-264	1	372	1	372
AKE81484.1	5.31e-264	1	372	1	372

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
12	26