CAZyme Information: MGYG000001431_00840

Basic Information

• Species: Helicobacter pylori_BU
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter; Helicobacter pylori_BU
• CAZyme ID: MGYG000001431_00840
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353	MGYG000001431_34|CGC1	39492.53	9.7949

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001431	1602443	Isolate	not provided	not provided

• Gene Location: Start: 37895; End: 38956 Strand: -

Full Sequence      

MKFALTGGGTGGHLSIAKALAIELEKQGIEAIYLGSTYGQDREWFENSPLFSERYFFNTQ
GVVNKSFFKKIGSLFLQAKAAFKAKEILKKHQITHTISVGGFSAGPASFASLLNHIPLYI
HEQNAIKGSLNRYLSPKAKAVFSSYAFKDKGHHVLTSYPVQNVFFDYARTRTEIKHILFL
GGSQGAKAINEFALLNAPKLTKQGIKITHICGSDAHERMRFFYQELGLLDKIELFAFHTN
IIEVMRQADLCVSRAGASSVWELCANGLPTIFIPYPFASNNHQYYNVLEFEKENLCYVAP
QNELLPKKLFEVIRKLNQKDDQGNKNLTTISAKLQQKIAKDGAKTIIETILSA

Enzyme Prediction     

No EC number prediction in MGYG000001431_00840.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	177	324	2.8e-41	0.8980891719745223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01133	murG	3.45e-122	13	350	13	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
PRK00726	murG	1.74e-112	13	353	14	354	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
COG0707	MurG	2.22e-99	13	352	13	353	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
cd03785	GT28_MurG	3.96e-87	13	348	12	349	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam04101	Glyco_tran_28_C	3.77e-51	176	346	1	166	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU81977.1	2.79e-254	1	353	1	353
SMA53070.1	1.33e-252	1	353	1	353
QEF41880.1	2.68e-252	1	353	1	353
AFI02876.1	3.81e-252	1	353	1	353
ADN80274.1	1.09e-251	1	353	1	353

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	5.53e-36	9	350	18	362	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
3S2U_A	5.12e-29	8	283	10	288	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	2.50e-23	2	304	8	310	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B6JMZ5	3.47e-249	1	353	1	353	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Helicobacter pylori (strain P12) OX=570508 GN=murG PE=3 SV=1
B2UUR4	8.16e-248	1	353	1	353	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Helicobacter pylori (strain Shi470) OX=512562 GN=murG PE=3 SV=1
B5Z8F1	4.72e-247	1	353	1	353	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Helicobacter pylori (strain G27) OX=563041 GN=murG PE=3 SV=1
Q1CSB1	9.12e-245	1	353	1	353	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Helicobacter pylori (strain HPAG1) OX=357544 GN=murG PE=3 SV=1
Q9ZK59	5.27e-244	1	353	1	353	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Helicobacter pylori (strain J99 / ATCC 700824) OX=85963 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001431_00840.